BP915913
Clone id YMU001_000079_D08
Library
Length 427
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000079_D08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AAGGGATGCGGCACTGGTAGGAAGGTTTGGTGCAGGTCTGGTGCCCTTCATGGCAAAAAT
TCTACCTCTCTTGCAGGTGTATACCGCATCCTTCTTTGCGATCCCAGCAGTAAGGTGGTT
TTCCCTGCAGAAGAAAAATGCAGACATTGTAAACAGGAATGCGGCAAGGGCTGAATGGAA
ACAGCTATTGCAACGGCCAGACTTGGTATTGCGAAAGAAGCTTGAGAGCTCATGGAATAT
GGCCAAGCAAACTATTATTGGGCGCGACAAAATTATCTACTCGACGCAGAAGGATATCAG
TGACCAGGACTTGGACGTTCAAGACTGGGAAAGGAGATTTACAGAGAGAGAACTCAGATG
ATGTGTCAGGACATTCATGGTTGTAACACTATTATTCTGTGTAAAACCTTATGAATGCCA
TTAAAGA
■■Homology search results ■■ -
sp_hit_id Q8GW20
Definition sp|Q8GW20|Y5390_ARATH Uncharacterized protein At5g03900 OS=Arabidopsis thaliana
Align length 106
Score (bit) 119.0
E-value 4.0e-27
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915913|Adiantum capillus-veneris mRNA, clone:
YMU001_000079_D08.
(427 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8GW20|Y5390_ARATH Uncharacterized protein At5g03900 OS=Arabi... 119 4e-27
sp|P23811|SCTR_RAT Secretin receptor OS=Rattus norvegicus GN=Sct... 30 1.0
sp|Q8BJM7|TYW1_MOUSE tRNA wybutosine-synthesizing protein 1 homo... 30 3.1
sp|Q8MEX3|MATK_EPHSI Maturase K OS=Ephedra sinica GN=matK PE=3 SV=2 30 3.1
sp|A7KAJ8|ATG13_PICAN Autophagy-related protein 13 OS=Pichia ang... 30 4.1
sp|Q8U1V2|PPNK_PYRFU Probable inorganic polyphosphate/ATP-NAD ki... 29 8.8
sp|P04265|K2C2_XENLA Keratin, type II cytoskeletal I (Fragment) ... 29 9.1
sp|Q0AKD6|AROE_MARMM Shikimate dehydrogenase OS=Maricaulis maris... 29 9.1

>sp|Q8GW20|Y5390_ARATH Uncharacterized protein At5g03900
OS=Arabidopsis thaliana GN=At5g03900 PE=2 SV=2
Length = 523

Score = 119 bits (299), Expect = 4e-27
Identities = 51/106 (48%), Positives = 79/106 (74%)
Frame = +2

Query: 35 GLVPFMAKILPLLQVYTASFFAIPAVRWFSLQKKNADIVNRNAARAEWKQLLQRPDLVLR 214
G + F+ I PLLQ+Y SFF IP +RWFS+++KN I NRN AR ++ + L+ PD+ LR
Sbjct: 415 GFLTFVKNIYPLLQIYAGSFFTIPLIRWFSIKRKNNQIENRNKARLQFARALESPDIALR 474

Query: 215 KKLESSWNMAKQTIIGRDKIIYSTQKDISDQDLDVQDWERRFTERE 352
+KL S+ +MA++T+IG+D+I+YST +D+ +Q+ + +W+RRF E E
Sbjct: 475 RKLLSARDMAQKTVIGKDRIVYSTDRDMMEQNYETDEWDRRFKELE 520


>sp|P23811|SCTR_RAT Secretin receptor OS=Rattus norvegicus GN=Sctr
PE=2 SV=1
Length = 449

Score = 29.6 bits (65), Expect(2) = 1.0
Identities = 14/53 (26%), Positives = 26/53 (49%)
Frame = +2

Query: 125 LQKKNADIVNRNAARAEWKQLLQRPDLVLRKKLESSWNMAKQTIIGRDKIIYS 283
L KN + RN + W + RPDL + +S+N + + + K++Y+
Sbjct: 96 LSNKNGSLF-RNCTQDGWSETFPRPDLACGVNINNSFNERRHAYLLKLKVMYT 147



Score = 21.2 bits (43), Expect(2) = 1.0
Identities = 10/36 (27%), Positives = 18/36 (50%)
Frame = +1

Query: 34 RSGALHGKNSTSLAGVYRILLCDPSSKVVFPAEEKC 141
+ GAL + ++ G++ + C PSS E +C
Sbjct: 54 KKGALGPETASGCEGLWDNMSCWPSSAPARTVEVQC 89


>sp|Q8BJM7|TYW1_MOUSE tRNA wybutosine-synthesizing protein 1 homolog
OS=Mus musculus GN=Tyw1 PE=2 SV=1
Length = 721

Score = 30.4 bits (67), Expect = 3.1
Identities = 11/31 (35%), Positives = 20/31 (64%)
Frame = +2

Query: 158 NAARAEWKQLLQRPDLVLRKKLESSWNMAKQ 250
N EW+ + +P+L+L++ +E+ NM KQ
Sbjct: 418 NPVGTEWRWKMDQPELILKEAIENHQNMIKQ 448


>sp|Q8MEX3|MATK_EPHSI Maturase K OS=Ephedra sinica GN=matK PE=3 SV=2
Length = 531

Score = 30.4 bits (67), Expect = 3.1
Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 1/64 (1%)
Frame = -2

Query: 258 IIVCLAIFHELSSFFRNTKSGRCNSCFH-SALAAFLFTMSAFFFCRENHLTAGIAKKDAV 82
+I C + + L S F + + R SCFH +L+ LF+ F + N LT KKD +
Sbjct: 202 VIFCFFLGNILLSIFEDFFTLRWKSCFHEKSLSYGLFSEQKHFQQKWNFLTRKPKKKDTI 261

Query: 81 YTCK 70
K
Sbjct: 262 RLLK 265


>sp|A7KAJ8|ATG13_PICAN Autophagy-related protein 13 OS=Pichia
angusta GN=ATG13 PE=3 SV=1
Length = 701

Score = 30.0 bits (66), Expect = 4.1
Identities = 18/60 (30%), Positives = 30/60 (50%)
Frame = +2

Query: 113 RWFSLQKKNADIVNRNAARAEWKQLLQRPDLVLRKKLESSWNMAKQTIIGRDKIIYSTQK 292
RWF+L N +I + K +L P LVL L+ + QT++ D I+ +++K
Sbjct: 67 RWFNLDLGNYEIPRTELSLWRNKDILSLPPLVLETFLDLRGLSSNQTLMLDDVIVKTSKK 126


>sp|Q8U1V2|PPNK_PYRFU Probable inorganic polyphosphate/ATP-NAD
kinase OS=Pyrococcus furiosus GN=ppnK PE=3 SV=1
Length = 277

Score = 28.9 bits (63), Expect = 8.8
Identities = 20/77 (25%), Positives = 35/77 (45%)
Frame = -3

Query: 239 YSMSSQASFAIPSLAVAIAVSIQPLPHSCLQCLHFSSAGKTTLLLGSQRRMRYTPAREVE 60
Y+MS+ F P L V + V + PLP + + + S+ L+ + + + E
Sbjct: 180 YAMSAGGPFVDPRLDVILVVPLLPLPKTSVPMVIPGSSRVDITLVSDREIILAIDGQYYE 239

Query: 59 FLP*RAPDLHQTFLPVP 9
+LP PD+ T + P
Sbjct: 240 YLP---PDVEITVVKSP 253


>sp|P04265|K2C2_XENLA Keratin, type II cytoskeletal I (Fragment)
OS=Xenopus laevis PE=2 SV=1
Length = 419

Score = 28.9 bits (63), Expect = 9.1
Identities = 13/52 (25%), Positives = 28/52 (53%)
Frame = +2

Query: 167 RAEWKQLLQRPDLVLRKKLESSWNMAKQTIIGRDKIIYSTQKDISDQDLDVQ 322
+ +++Q+ QR L + + +QT+ G I +++ +ISD +L +Q
Sbjct: 137 KCQYEQIAQRSKLEAEALYDQRYKQLQQTVEGHGDSIKNSKTEISDLNLKIQ 188


>sp|Q0AKD6|AROE_MARMM Shikimate dehydrogenase OS=Maricaulis maris
(strain MCS10) GN=aroE PE=3 SV=1
Length = 280

Score = 28.9 bits (63), Expect = 9.1
Identities = 19/63 (30%), Positives = 27/63 (42%)
Frame = +2

Query: 146 IVNRNAARAEWKQLLQRPDLVLRKKLESSWNMAKQTIIGRDKIIYSTQKDISDQDLDVQD 325
I NRN RA+ PD + W + GRD II +T ++ +D D
Sbjct: 153 ICNRNITRAQGLSRDIAPDAGI-----IPWEARDDALQGRDLIINATSLGLAGRDELALD 207

Query: 326 WER 334
W+R
Sbjct: 208 WQR 210


tr_hit_id A9TMW8
Definition tr|A9TMW8|A9TMW8_PHYPA Predicted protein (Fragment) OS=Physcomitrella patens subsp. patens
Align length 116
Score (bit) 129.0
E-value 1.0e-28
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915913|Adiantum capillus-veneris mRNA, clone:
YMU001_000079_D08.
(427 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TMW8|A9TMW8_PHYPA Predicted protein (Fragment) OS=Physcomit... 129 1e-28
tr|A7PPD4|A7PPD4_VITVI Chromosome chr8 scaffold_23, whole genome... 119 8e-26
tr|B8LPE9|B8LPE9_PICSI Putative uncharacterized protein OS=Picea... 118 2e-25
tr|B8AJ12|B8AJ12_ORYSI Putative uncharacterized protein OS=Oryza... 113 5e-24
tr|Q6ESE4|Q6ESE4_ORYSJ Putative uncharacterized protein P0605D08... 112 7e-24
tr|Q0E0P6|Q0E0P6_ORYSJ Os02g0533000 protein OS=Oryza sativa subs... 112 7e-24
tr|A3A7M1|A3A7M1_ORYSJ Putative uncharacterized protein OS=Oryza... 112 7e-24
tr|B7ZYB9|B7ZYB9_MAIZE Putative uncharacterized protein OS=Zea m... 109 6e-23
tr|A5ASH3|A5ASH3_VITVI Putative uncharacterized protein (Fragmen... 102 1e-20
tr|A3IH51|A3IH51_9CHRO Putative uncharacterized protein OS=Cyano... 82 1e-14
tr|B1WWP6|B1WWP6_CYAA5 Putative uncharacterized protein OS=Cyano... 80 7e-14
tr|B1XLA7|B1XLA7_SYNP2 Putative uncharacterized protein OS=Synec... 79 1e-13
tr|B4VKQ3|B4VKQ3_9CYAN Putative uncharacterized protein OS=Micro... 77 4e-13
tr|Q4C3V9|Q4C3V9_CROWT Putative uncharacterized protein OS=Croco... 73 8e-12
tr|A0ZMS6|A0ZMS6_NODSP Putative uncharacterized protein OS=Nodul... 73 8e-12
tr|A9TZ11|A9TZ11_PHYPA Predicted protein OS=Physcomitrella paten... 72 1e-11
tr|Q31MR2|Q31MR2_SYNE7 Putative uncharacterized protein OS=Synec... 72 2e-11
tr|B2J3C4|B2J3C4_NOSP7 Putative uncharacterized protein OS=Nosto... 71 2e-11
tr|Q3M5B8|Q3M5B8_ANAVT Putative uncharacterized protein OS=Anaba... 70 7e-11
tr|Q2JTP4|Q2JTP4_SYNJA Putative uncharacterized protein OS=Synec... 69 1e-10
tr|B0CBT1|B0CBT1_ACAM1 Putative uncharacterized protein OS=Acary... 69 1e-10
tr|Q5N5Z2|Q5N5Z2_SYNP6 Putative uncharacterized protein OS=Synec... 68 3e-10
tr|B7JXK4|B7JXK4_SYNP8 Putative uncharacterized protein OS=Synec... 67 3e-10
tr|B4BVI4|B4BVI4_9CHRO Putative uncharacterized protein OS=Cyano... 67 3e-10
tr|Q2JL37|Q2JL37_SYNJB Putative uncharacterized protein OS=Synec... 67 4e-10
tr|B5W645|B5W645_SPIMA Putative uncharacterized protein OS=Arthr... 66 8e-10
tr|A0YXB3|A0YXB3_9CYAN Putative uncharacterized protein OS=Lyngb... 66 1e-09
tr|Q8YWK7|Q8YWK7_ANASP All1606 protein OS=Anabaena sp. (strain P... 65 2e-09
tr|Q8DIX8|Q8DIX8_THEEB Tll1453 protein OS=Thermosynechococcus el... 65 2e-09
tr|Q118J0|Q118J0_TRIEI Putative uncharacterized protein OS=Trich... 62 2e-08

>tr|A9TMW8|A9TMW8_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_2268 PE=4 SV=1
Length = 413

Score = 129 bits (323), Expect = 1e-28
Identities = 64/116 (55%), Positives = 82/116 (70%), Gaps = 1/116 (0%)
Frame = +2

Query: 2 RDAALVGRF-GAGLVPFMAKILPLLQVYTASFFAIPAVRWFSLQKKNADIVNRNAARAEW 178
RD + + F G+GL+PF K LP LQ YTASFFAIPA RWF LQ++NA I RN AR W
Sbjct: 298 RDYSFIQSFRGSGLIPFAFKALPFLQAYTASFFAIPAFRWFLLQRRNAQIEQRNNARLGW 357

Query: 179 KQLLQRPDLVLRKKLESSWNMAKQTIIGRDKIIYSTQKDISDQDLDVQDWERRFTE 346
L R LR+KL+S+ + AK+T++GRD+IIYST+ DIS QD + +DWE+R E
Sbjct: 358 LAALDRAGAELRQKLKSARDSAKRTVLGRDRIIYSTETDISTQDYEAKDWEQRLKE 413


>tr|A7PPD4|A7PPD4_VITVI Chromosome chr8 scaffold_23, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00021608001
PE=4 SV=1
Length = 508

Score = 119 bits (298), Expect = 8e-26
Identities = 55/107 (51%), Positives = 78/107 (72%)
Frame = +2

Query: 32 AGLVPFMAKILPLLQVYTASFFAIPAVRWFSLQKKNADIVNRNAARAEWKQLLQRPDLVL 211
+G + F++ I PLLQ+Y SFFAIP RWF ++ KNA I RN AR + L+ PDL L
Sbjct: 399 SGFITFVSDIFPLLQIYAGSFFAIPLTRWFLIRNKNAKIEKRNLARELRARALELPDLSL 458

Query: 212 RKKLESSWNMAKQTIIGRDKIIYSTQKDISDQDLDVQDWERRFTERE 352
R+KL S+ +MA++T+IG+D+I+YST +D+ +QD D QDW++RF E E
Sbjct: 459 RRKLLSARDMAQRTVIGQDRIVYSTDRDLFEQDYDTQDWDQRFREIE 505


>tr|B8LPE9|B8LPE9_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 362

Score = 118 bits (295), Expect = 2e-25
Identities = 55/106 (51%), Positives = 76/106 (71%)
Frame = +2

Query: 35 GLVPFMAKILPLLQVYTASFFAIPAVRWFSLQKKNADIVNRNAARAEWKQLLQRPDLVLR 214
G + F+ I PLLQ+Y ASFFAIP RWF ++KKN +I RN AR + L+ PD +R
Sbjct: 254 GFLSFVTDIFPLLQIYAASFFAIPLSRWFLIRKKNMEIDERNRARKQRALALEMPDPTVR 313

Query: 215 KKLESSWNMAKQTIIGRDKIIYSTQKDISDQDLDVQDWERRFTERE 352
+K+ES+ MA++T+IG D+IIYS++KD +QD D ++WERRF E E
Sbjct: 314 QKIESARAMAERTVIGADRIIYSSEKDFGEQDYDAKEWERRFRELE 359


>tr|B8AJ12|B8AJ12_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_07523 PE=4 SV=1
Length = 400

Score = 113 bits (282), Expect = 5e-24
Identities = 55/106 (51%), Positives = 77/106 (72%)
Frame = +2

Query: 35 GLVPFMAKILPLLQVYTASFFAIPAVRWFSLQKKNADIVNRNAARAEWKQLLQRPDLVLR 214
GL+ F+A++ PLLQVY SFFAIP RWF L+K N DI RN AR + Q L P+ LR
Sbjct: 293 GLISFVAQLFPLLQVYAGSFFAIPLFRWFLLRKTNNDIERRNKAREQRAQELALPESSLR 352

Query: 215 KKLESSWNMAKQTIIGRDKIIYSTQKDISDQDLDVQDWERRFTERE 352
+KL S+ +MA++ +I ++IIY+T+KD+ DQD +V++WE+RF E E
Sbjct: 353 RKLLSARDMAQRKVITPEEIIYTTEKDLLDQDYEVKEWEKRFKELE 398


>tr|Q6ESE4|Q6ESE4_ORYSJ Putative uncharacterized protein P0605D08.33
OS=Oryza sativa subsp. japonica GN=P0605D08.33 PE=4 SV=1
Length = 528

Score = 112 bits (281), Expect = 7e-24
Identities = 54/106 (50%), Positives = 77/106 (72%)
Frame = +2

Query: 35 GLVPFMAKILPLLQVYTASFFAIPAVRWFSLQKKNADIVNRNAARAEWKQLLQRPDLVLR 214
GL+ F+A++ PLLQVY SFFAIP RWF L+K N DI RN AR + Q L P+ LR
Sbjct: 421 GLISFVAQLFPLLQVYAGSFFAIPLFRWFLLRKTNNDIERRNKAREQRAQELALPESSLR 480

Query: 215 KKLESSWNMAKQTIIGRDKIIYSTQKDISDQDLDVQDWERRFTERE 352
+KL S+ +MA++ +I ++I+Y+T+KD+ DQD +V++WE+RF E E
Sbjct: 481 RKLLSARDMAQRKVITPEEIVYTTEKDLLDQDYEVKEWEKRFKELE 526


>tr|Q0E0P6|Q0E0P6_ORYSJ Os02g0533000 protein OS=Oryza sativa subsp.
japonica GN=Os02g0533000 PE=4 SV=1
Length = 527

Score = 112 bits (281), Expect = 7e-24
Identities = 54/106 (50%), Positives = 77/106 (72%)
Frame = +2

Query: 35 GLVPFMAKILPLLQVYTASFFAIPAVRWFSLQKKNADIVNRNAARAEWKQLLQRPDLVLR 214
GL+ F+A++ PLLQVY SFFAIP RWF L+K N DI RN AR + Q L P+ LR
Sbjct: 420 GLISFVAQLFPLLQVYAGSFFAIPLFRWFLLRKTNNDIERRNKAREQRAQELALPESSLR 479

Query: 215 KKLESSWNMAKQTIIGRDKIIYSTQKDISDQDLDVQDWERRFTERE 352
+KL S+ +MA++ +I ++I+Y+T+KD+ DQD +V++WE+RF E E
Sbjct: 480 RKLLSARDMAQRKVITPEEIVYTTEKDLLDQDYEVKEWEKRFKELE 525


>tr|A3A7M1|A3A7M1_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_006793 PE=4 SV=1
Length = 437

Score = 112 bits (281), Expect = 7e-24
Identities = 54/106 (50%), Positives = 77/106 (72%)
Frame = +2

Query: 35 GLVPFMAKILPLLQVYTASFFAIPAVRWFSLQKKNADIVNRNAARAEWKQLLQRPDLVLR 214
GL+ F+A++ PLLQVY SFFAIP RWF L+K N DI RN AR + Q L P+ LR
Sbjct: 330 GLISFVAQLFPLLQVYAGSFFAIPLFRWFLLRKTNNDIERRNKAREQRAQELALPESSLR 389

Query: 215 KKLESSWNMAKQTIIGRDKIIYSTQKDISDQDLDVQDWERRFTERE 352
+KL S+ +MA++ +I ++I+Y+T+KD+ DQD +V++WE+RF E E
Sbjct: 390 RKLLSARDMAQRKVITPEEIVYTTEKDLLDQDYEVKEWEKRFKELE 435


>tr|B7ZYB9|B7ZYB9_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 522

Score = 109 bits (273), Expect = 6e-23
Identities = 53/106 (50%), Positives = 75/106 (70%)
Frame = +2

Query: 35 GLVPFMAKILPLLQVYTASFFAIPAVRWFSLQKKNADIVNRNAARAEWKQLLQRPDLVLR 214
GL+ F A++ PLLQ+Y SFFAIP RWF L+K N I RN AR + Q L PD LR
Sbjct: 415 GLISFAAQLYPLLQIYAGSFFAIPLFRWFLLRKTNNGIKKRNKAREQRAQELVSPDSSLR 474

Query: 215 KKLESSWNMAKQTIIGRDKIIYSTQKDISDQDLDVQDWERRFTERE 352
+KL S+ +MA++ +I ++I+Y+T+KD+ +QD +V++WERRF E E
Sbjct: 475 RKLLSARDMAERKVITPEEIVYTTEKDLLEQDYEVKEWERRFKELE 520


>tr|A5ASH3|A5ASH3_VITVI Putative uncharacterized protein (Fragment)
OS=Vitis vinifera GN=VITISV_021812 PE=4 SV=1
Length = 615

Score = 102 bits (254), Expect = 1e-20
Identities = 48/90 (53%), Positives = 66/90 (73%)
Frame = +2

Query: 83 TASFFAIPAVRWFSLQKKNADIVNRNAARAEWKQLLQRPDLVLRKKLESSWNMAKQTIIG 262
+ SFFAIP RWF ++ KNA I RN AR + L+ PDL LR+KL S+ NMA++T+IG
Sbjct: 442 SGSFFAIPLTRWFLIRNKNAKIEKRNLARELRARALELPDLSLRRKLLSARNMAQRTVIG 501

Query: 263 RDKIIYSTQKDISDQDLDVQDWERRFTERE 352
+D+I+YST +D+ +QD D QDW++RF E E
Sbjct: 502 QDRIVYSTDRDLFEQDYDTQDWDQRFREIE 531


>tr|A3IH51|A3IH51_9CHRO Putative uncharacterized protein
OS=Cyanothece sp. CCY 0110 GN=CY0110_10472 PE=4 SV=1
Length = 441

Score = 82.4 bits (202), Expect = 1e-14
Identities = 45/117 (38%), Positives = 71/117 (60%), Gaps = 5/117 (4%)
Frame = +2

Query: 2 RDAALVGRFGAGLVPFMAKILPLLQVYTASFFAIPAVRWFSLQKKNADIVNRNAARAEWK 181
+D A+V +FG G + F+ I LL Y +F IPA+R+F +Q +N+ I RNA R E
Sbjct: 320 KDPAIVAQFG-GFIAFVNSIYWLLLGYAIAFLGIPAIRYFVVQARNSKIEERNAKRQERT 378

Query: 182 QLLQRPDLVLRKKLESSWNMAKQTIIGRDKIIYSTQKDISDQDLDV-----QDWERR 337
+LLQ D ++ KLE + A Q I+ + I Y+T+KDI +Q+++ Q+W++R
Sbjct: 379 KLLQNKDQTIQHKLEYASQFATQAILQQSDIAYTTEKDILEQEIEQADKIDQEWKKR 435