BP915927
Clone id YMU001_000079_E12
Library
Length 441
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000079_E12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTCTATGTCTAGATCATGCCAAGCGTGAGCAGCAACAGCACGACGAGTCATAGAGGAAAG
GATCCGCTCGTTCAGAGGTGGGTGGGGGACACGTGAACCTTTTCCCAGGGGAACCATTGT
CAGTCCATGATACCTTGCGTTCAGCTTCAGCTGGCACAGCCGTGCCGTTCTCTGAGCTCA
TCTCTCACCAAAATGAAGGTTTACTGCTCTGCTCGTGCTGCAAGTTTCCCCAAACTCCCG
AGAGAAGACAATGCCGCTAAAAGGAGGTATGGCAGCAAGGTCATCCGCTGAGGCTAATAA
TAATGAAAGTGCATCATCTACCAGGTCTTCTACAGGTGCTGAAATGTATGTGTAAAGGCG
ATGCACGCTGGAGGCTGGGAAGAAGCAGATGGGTGGAGGGACTTTTTTGGCGAAAAAATG
CAGTTGGGAAACGTGAAGCGA
■■Homology search results ■■ -
sp_hit_id Q0DYB1
Definition sp|Q0DYB1|IPYR_ORYSJ Soluble inorganic pyrophosphatase OS=Oryza sativa subsp. japonica
Align length 32
Score (bit) 48.5
E-value 1.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915927|Adiantum capillus-veneris mRNA, clone:
YMU001_000079_E12.
(441 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q0DYB1|IPYR_ORYSJ Soluble inorganic pyrophosphatase OS=Oryza ... 49 1e-05
sp|A2X8Q3|IPYR_ORYSI Soluble inorganic pyrophosphatase OS=Oryza ... 49 1e-05
sp|O48556|IPYR_MAIZE Soluble inorganic pyrophosphatase OS=Zea ma... 47 4e-05
sp|Q43187|IPYR_SOLTU Soluble inorganic pyrophosphatase OS=Solanu... 46 6e-05
sp|O23979|IPYR_HORVD Soluble inorganic pyrophosphatase OS=Hordeu... 44 2e-04
sp|P21216|IPYR2_ARATH Soluble inorganic pyrophosphatase 2 OS=Ara... 38 0.016
sp|Q9S850|SUOX_ARATH Sulfite oxidase OS=Arabidopsis thaliana GN=... 29 7.5
sp|Q971J2|RLA0_SULTO Acidic ribosomal protein P0 homolog OS=Sulf... 29 7.5
sp|A9JS71|ECHD3_XENLA Enoyl-CoA hydratase domain-containing prot... 29 7.5
sp|Q07116|SUOX_RAT Sulfite oxidase, mitochondrial OS=Rattus norv... 29 9.8
sp|Q8R086|SUOX_MOUSE Sulfite oxidase, mitochondrial OS=Mus muscu... 29 9.8
sp|Q60HD0|SUOX_MACFA Sulfite oxidase, mitochondrial OS=Macaca fa... 29 9.8
sp|P51687|SUOX_HUMAN Sulfite oxidase, mitochondrial OS=Homo sapi... 29 9.8
sp|P22064|LTB1S_HUMAN Latent-transforming growth factor beta-bin... 29 9.8
sp|Q14766|LTB1L_HUMAN Latent-transforming growth factor beta-bin... 29 9.8
sp|P12263|FA8_PIG Coagulation factor VIII OS=Sus scrofa GN=F8 PE... 29 9.8

>sp|Q0DYB1|IPYR_ORYSJ Soluble inorganic pyrophosphatase OS=Oryza
sativa subsp. japonica GN=IPP PE=2 SV=1
Length = 214

Score = 48.5 bits (114), Expect = 1e-05
Identities = 22/32 (68%), Positives = 26/32 (81%)
Frame = -1

Query: 99 GSRVPHPPLNERILSSMTRRAVAAHAWHDLDI 4
GSR P LNERILSSM+++ VAAH WHDL+I
Sbjct: 12 GSRYPPAALNERILSSMSQKHVAAHPWHDLEI 43


>sp|A2X8Q3|IPYR_ORYSI Soluble inorganic pyrophosphatase OS=Oryza
sativa subsp. indica GN=IPP PE=2 SV=1
Length = 214

Score = 48.5 bits (114), Expect = 1e-05
Identities = 22/32 (68%), Positives = 26/32 (81%)
Frame = -1

Query: 99 GSRVPHPPLNERILSSMTRRAVAAHAWHDLDI 4
GSR P LNERILSSM+++ VAAH WHDL+I
Sbjct: 12 GSRYPPAALNERILSSMSQKHVAAHPWHDLEI 43


>sp|O48556|IPYR_MAIZE Soluble inorganic pyrophosphatase OS=Zea
mays GN=IPP PE=2 SV=1
Length = 214

Score = 47.0 bits (110), Expect = 4e-05
Identities = 20/26 (76%), Positives = 24/26 (92%)
Frame = -1

Query: 81 PPLNERILSSMTRRAVAAHAWHDLDI 4
P LNERILSS++RR+VAAH WHDL+I
Sbjct: 18 PKLNERILSSLSRRSVAAHPWHDLEI 43


>sp|Q43187|IPYR_SOLTU Soluble inorganic pyrophosphatase OS=Solanum
tuberosum GN=PPA PE=2 SV=1
Length = 211

Score = 46.2 bits (108), Expect = 6e-05
Identities = 20/26 (76%), Positives = 24/26 (92%)
Frame = -1

Query: 81 PPLNERILSSMTRRAVAAHAWHDLDI 4
P LNERILSS++RR+VAAH WHDL+I
Sbjct: 15 PRLNERILSSISRRSVAAHPWHDLEI 40


>sp|O23979|IPYR_HORVD Soluble inorganic pyrophosphatase OS=Hordeum
vulgare var. distichum GN=IPP PE=2 SV=1
Length = 215

Score = 44.3 bits (103), Expect = 2e-04
Identities = 19/28 (67%), Positives = 22/28 (78%)
Frame = -1

Query: 87 PHPPLNERILSSMTRRAVAAHAWHDLDI 4
P P LNERILSS++RR AH WHDL+I
Sbjct: 19 PAPKLNERILSSLSRRGGGAHPWHDLEI 46


>sp|P21216|IPYR2_ARATH Soluble inorganic pyrophosphatase 2
OS=Arabidopsis thaliana GN=PPA2 PE=2 SV=2
Length = 218

Score = 38.1 bits (87), Expect = 0.016
Identities = 16/30 (53%), Positives = 21/30 (70%)
Frame = -1

Query: 93 RVPHPPLNERILSSMTRRAVAAHAWHDLDI 4
R P+ LNER ++ T R+ AAH WHDL+I
Sbjct: 18 RNPNVTLNERNFAAFTHRSAAAHPWHDLEI 47


>sp|Q9S850|SUOX_ARATH Sulfite oxidase OS=Arabidopsis thaliana GN=SOX
PE=1 SV=1
Length = 393

Score = 29.3 bits (64), Expect = 7.5
Identities = 14/49 (28%), Positives = 23/49 (46%)
Frame = +3

Query: 282 HPLRLIIMKVHHLPGLLQVLKCMCKGDARWRLGRSRWVEGLFWRKNAVG 428
+P +L I + LP C G+ R + + R V G+ W +A+G
Sbjct: 75 NPRKLFIKDIRSLPKYNVTATLQCAGNRRTAMSKVRNVRGVGWDVSAIG 123


>sp|Q971J2|RLA0_SULTO Acidic ribosomal protein P0 homolog
OS=Sulfolobus tokodaii GN=rplP0 PE=3 SV=1
Length = 337

Score = 29.3 bits (64), Expect = 7.5
Identities = 11/31 (35%), Positives = 22/31 (70%)
Frame = +3

Query: 18 AKREQQQHDES*RKGSARSEVGGGHVNLFPG 110
A++++++ +E +KG + E+GGG +LF G
Sbjct: 307 AEKKEEKKEEEEKKGPSEEEIGGGLSSLFGG 337


>sp|A9JS71|ECHD3_XENLA Enoyl-CoA hydratase domain-containing protein
3, mitochondrial OS=Xenopus laevis GN=echdc3 PE=2 SV=1
Length = 294

Score = 29.3 bits (64), Expect = 7.5
Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 1/39 (2%)
Frame = +3

Query: 99 LFPGEPLSVHDTLRSASAGTAVPFSELISHQNE-GLLLC 212
LF GEP+S HD L VP L S N L +C
Sbjct: 196 LFTGEPISAHDALLHGLVSKVVPEENLKSETNRIALKIC 234


>sp|Q07116|SUOX_RAT Sulfite oxidase, mitochondrial OS=Rattus
norvegicus GN=Suox PE=1 SV=2
Length = 546

Score = 28.9 bits (63), Expect = 9.8
Identities = 14/49 (28%), Positives = 23/49 (46%)
Frame = +3

Query: 279 GHPLRLIIMKVHHLPGLLQVLKCMCKGDARWRLGRSRWVEGLFWRKNAV 425
G L L + +H P + C G+ R + + + V+GL WR A+
Sbjct: 241 GQSLSLSLDDLHKFPKHEVTVTLQCAGNRRSEMNKVKEVKGLEWRTGAI 289


tr_hit_id A9NMY6
Definition tr|A9NMY6|A9NMY6_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 34
Score (bit) 59.7
E-value 7.0e-08
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915927|Adiantum capillus-veneris mRNA, clone:
YMU001_000079_E12.
(441 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NMY6|A9NMY6_PICSI Putative uncharacterized protein OS=Picea... 60 7e-08
tr|Q9M611|Q9M611_MALDO Soluble inorganic pyrophosphatase OS=Malu... 55 1e-06
tr|O49949|O49949_SOLTU Magnesium dependent soluble inorganic pyr... 55 2e-06
tr|A9PAT6|A9PAT6_POPTR Putative uncharacterized protein OS=Popul... 54 3e-06
tr|Q6KBB0|Q6KBB0_ARAHY Putative inorganic pyrophosphatase OS=Ara... 52 1e-05
tr|A9U500|A9U500_PHYPA Predicted protein OS=Physcomitrella paten... 50 6e-05
tr|Q2P9V0|Q2P9V0_9MAGN Soluble inorganic pyrophosphatase OS=Papa... 50 7e-05
tr|Q75HX3|Q75HX3_ORYSJ Os05g0438500 protein OS=Oryza sativa subs... 49 1e-04
tr|Q5N9F4|Q5N9F4_ORYSJ cDNA clone:J023060L20, full insert sequen... 49 1e-04
tr|A9PJT3|A9PJT3_POPJC Putative uncharacterized protein OS=Popul... 49 1e-04
tr|A9PC87|A9PC87_POPTR Putative uncharacterized protein OS=Popul... 49 1e-04
tr|A2Y531|A2Y531_ORYSI Putative uncharacterized protein OS=Oryza... 49 1e-04
tr|A2WXB3|A2WXB3_ORYSI Putative uncharacterized protein OS=Oryza... 49 1e-04
tr|Q9MAM9|Q9MAM9_ARATH T25K16.5 OS=Arabidopsis thaliana PE=4 SV=1 49 2e-04
tr|Q93V56|Q93V56_ARATH At1g01050/T25K16_5 (Putative soluble inor... 49 2e-04
tr|B7E5N1|B7E5N1_ORYSJ cDNA clone:001-017-G06, full insert seque... 49 2e-04
tr|Q75L10|Q75L10_ORYSJ Os05g0114000 protein OS=Oryza sativa subs... 48 2e-04
tr|Q2HTA8|Q2HTA8_MEDTR Inorganic pyrophosphatase OS=Medicago tru... 48 2e-04
tr|B8AXA3|B8AXA3_ORYSI Putative uncharacterized protein OS=Oryza... 48 2e-04
tr|B4FJX6|B4FJX6_MAIZE Putative uncharacterized protein OS=Zea m... 48 2e-04
tr|A3AZA3|A3AZA3_ORYSJ Putative uncharacterized protein OS=Oryza... 48 2e-04
tr|Q8GXR0|Q8GXR0_ARATH Putative inorganic pyrophosphatase OS=Ara... 47 4e-04
tr|O82793|O82793_ARATH Putative inorganic pyrophosphatase (At2g4... 47 4e-04
tr|O82597|O82597_ARATH Putative inorganic phosphatase OS=Arabido... 47 4e-04
tr|Q7XTL6|Q7XTL6_ORYSJ Os04g0687100 protein OS=Oryza sativa subs... 47 5e-04
tr|Q5JL11|Q5JL11_ORYSJ Putative soluble inorganic pyrophosphatas... 47 5e-04
tr|Q56US1|Q56US1_ORYSJ Inorganic pyrophosphatase (Fragment) OS=O... 47 5e-04
tr|Q2P9V1|Q2P9V1_9MAGN Soluble inorganic pyrophosphatase OS=Papa... 47 5e-04
tr|Q259L2|Q259L2_ORYSA H0701F11.4 protein OS=Oryza sativa GN=H07... 47 5e-04
tr|Q0JFK7|Q0JFK7_ORYSJ Os01g0974700 protein OS=Oryza sativa subs... 47 5e-04

>tr|A9NMY6|A9NMY6_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 216

Score = 59.7 bits (143), Expect = 7e-08
Identities = 26/34 (76%), Positives = 30/34 (88%)
Frame = -1

Query: 105 GKGSRVPHPPLNERILSSMTRRAVAAHAWHDLDI 4
G SR PHPPLNERILSS++RR+VAAH WHDL+I
Sbjct: 12 GGESRFPHPPLNERILSSLSRRSVAAHPWHDLEI 45


>tr|Q9M611|Q9M611_MALDO Soluble inorganic pyrophosphatase OS=Malus
domestica PE=2 SV=1
Length = 228

Score = 55.5 bits (132), Expect = 1e-06
Identities = 23/27 (85%), Positives = 26/27 (96%)
Frame = -1

Query: 84 HPPLNERILSSMTRRAVAAHAWHDLDI 4
HPPLNERILSSMTRR++AAH WHDL+I
Sbjct: 31 HPPLNERILSSMTRRSIAAHPWHDLEI 57


>tr|O49949|O49949_SOLTU Magnesium dependent soluble inorganic
pyrophosphatase OS=Solanum tuberosum GN=ppa2 PE=2 SV=1
Length = 217

Score = 54.7 bits (130), Expect = 2e-06
Identities = 24/27 (88%), Positives = 26/27 (96%)
Frame = -1

Query: 81 PPLNERILSSMTRRAVAAHAWHDLDIE 1
PPLNERILSSMTRR+VAAH WHDL+IE
Sbjct: 20 PPLNERILSSMTRRSVAAHPWHDLEIE 46


>tr|A9PAT6|A9PAT6_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 216

Score = 54.3 bits (129), Expect = 3e-06
Identities = 26/42 (61%), Positives = 31/42 (73%), Gaps = 6/42 (14%)
Frame = -1

Query: 111 PLGKGSRVP------HPPLNERILSSMTRRAVAAHAWHDLDI 4
P+ S++P HPPLNERILSSM RR+VAAH WHDL+I
Sbjct: 4 PIETPSKLPISRHSSHPPLNERILSSMNRRSVAAHPWHDLEI 45


>tr|Q6KBB0|Q6KBB0_ARAHY Putative inorganic pyrophosphatase
OS=Arachis hypogaea GN=pah767 PE=2 SV=1
Length = 216

Score = 52.0 bits (123), Expect = 1e-05
Identities = 22/26 (84%), Positives = 25/26 (96%)
Frame = -1

Query: 81 PPLNERILSSMTRRAVAAHAWHDLDI 4
PPLNERI+SSMTRR+VAAH WHDL+I
Sbjct: 20 PPLNERIISSMTRRSVAAHPWHDLEI 45


>tr|A9U500|A9U500_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_156544 PE=4 SV=1
Length = 218

Score = 50.1 bits (118), Expect = 6e-05
Identities = 24/44 (54%), Positives = 30/44 (68%), Gaps = 2/44 (4%)
Frame = -1

Query: 129 HGLTMVPLGKGSRVPHP--PLNERILSSMTRRAVAAHAWHDLDI 4
+G+ VP KGS H PLN RI+++M RR VAAH WHDL+I
Sbjct: 4 NGVAAVPSKKGSTAVHKATPLNSRIMTTMERRTVAAHPWHDLEI 47


>tr|Q2P9V0|Q2P9V0_9MAGN Soluble inorganic pyrophosphatase OS=Papaver
rhoeas GN=p26.1b PE=2 SV=1
Length = 236

Score = 49.7 bits (117), Expect = 7e-05
Identities = 25/45 (55%), Positives = 29/45 (64%)
Frame = -1

Query: 138 ARYHGLTMVPLGKGSRVPHPPLNERILSSMTRRAVAAHAWHDLDI 4
A+ L + S P LNERILSSM+RRAVAAH WHDL+I
Sbjct: 21 AKNKTLNAIKAASYSSHARPSLNERILSSMSRRAVAAHPWHDLEI 65


>tr|Q75HX3|Q75HX3_ORYSJ Os05g0438500 protein OS=Oryza sativa subsp.
japonica GN=OSJNBb0042J17.9 PE=2 SV=1
Length = 224

Score = 48.9 bits (115), Expect = 1e-04
Identities = 21/28 (75%), Positives = 25/28 (89%)
Frame = -1

Query: 87 PHPPLNERILSSMTRRAVAAHAWHDLDI 4
P P LNERILSS++RR+VAAH WHDL+I
Sbjct: 26 PGPKLNERILSSLSRRSVAAHPWHDLEI 53


>tr|Q5N9F4|Q5N9F4_ORYSJ cDNA clone:J023060L20, full insert sequence
OS=Oryza sativa subsp. japonica GN=P0505D12.37 PE=2 SV=1
Length = 212

Score = 48.9 bits (115), Expect = 1e-04
Identities = 22/33 (66%), Positives = 26/33 (78%)
Frame = -1

Query: 105 GKGSRVPHPPLNERILSSMTRRAVAAHAWHDLD 7
G + P P LNERILSS++RR+VAAH WHDLD
Sbjct: 9 GAKPKRPAPRLNERILSSLSRRSVAAHPWHDLD 41


>tr|A9PJT3|A9PJT3_POPJC Putative uncharacterized protein OS=Populus
jackii PE=2 SV=1
Length = 212

Score = 48.9 bits (115), Expect = 1e-04
Identities = 23/33 (69%), Positives = 27/33 (81%), Gaps = 1/33 (3%)
Frame = -1

Query: 99 GSRVPHPP-LNERILSSMTRRAVAAHAWHDLDI 4
G R PP LNERILSSM+RR++AAH WHDL+I
Sbjct: 9 GKRAGWPPVLNERILSSMSRRSIAAHPWHDLEI 41