BP915946
Clone id YMU001_000079_H03
Library
Length 291
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000079_H03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AACTTGTACCAAGCTTAACACAAAGTGCAGGCAACAAGAAGCAAGCATCTTCTGACTTGA
AAACTATCCCAACATCTATTCACCTACCTGTAAATACTATACAAACCATCTTCAACTCCT
GATCAAAGGGTAAAGAAGACAAAAGGCTCCTGCCAATAACAACAGAAGCAATGTGACGAC
TCCTAGGCAGCTCCGGAAAACCCTGCCTCAGCATGCTTCCAAGTTTATACATTCGCTTGA
TGCTTTCTTATAAAAAAAAGCACCTAAGCAGGTACAACGTAGGGATGTTTC
■■Homology search results ■■ -
sp_hit_id P55747
Definition sp|P55747|CBP21_HORVU Serine carboxypeptidase II-1 (Fragment) OS=Hordeum vulgare
Align length 44
Score (bit) 30.4
E-value 2.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915946|Adiantum capillus-veneris mRNA, clone:
YMU001_000079_H03.
(291 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P55747|CBP21_HORVU Serine carboxypeptidase II-1 (Fragment) OS... 30 2.8
sp|Q5UQP5|YR457_MIMIV Uncharacterized protein R457 OS=Acanthamoe... 29 8.2

>sp|P55747|CBP21_HORVU Serine carboxypeptidase II-1 (Fragment)
OS=Hordeum vulgare GN=CXP;2-1 PE=1 SV=1
Length = 324

Score = 30.4 bits (67), Expect = 2.8
Identities = 17/44 (38%), Positives = 24/44 (54%)
Frame = +2

Query: 5 CTKLNTKCRQQEASIF*LENYPNIYSPTCKYYTNHLQLLIKG*R 136
C K+N +E I + +IY+PTCK + H + LIKG R
Sbjct: 121 CNKINNVAEAEEGLI----DAYSIYTPTCKKTSLHRRRLIKGRR 160


>sp|Q5UQP5|YR457_MIMIV Uncharacterized protein R457 OS=Acanthamoeba
polyphaga mimivirus GN=MIMI_R457 PE=1 SV=1
Length = 189

Score = 28.9 bits (63), Expect = 8.2
Identities = 12/32 (37%), Positives = 20/32 (62%)
Frame = +2

Query: 137 RQKAPANNNRSNVTTPRQLRKTLPQHASKFIH 232
+Q+AP + N+ + TPR+ +L H S+F H
Sbjct: 79 QQQAPESLNQYTMYTPRECSPSLESHHSRFSH 110


tr_hit_id A2C0Y3
Definition tr|A2C0Y3|A2C0Y3_PROM1 Phage integrase family OS=Prochlorococcus marinus (strain NATL1A)
Align length 89
Score (bit) 33.9
E-value 4.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915946|Adiantum capillus-veneris mRNA, clone:
YMU001_000079_H03.
(291 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A2C0Y3|A2C0Y3_PROM1 Phage integrase family OS=Prochlorococcus... 34 4.2

>tr|A2C0Y3|A2C0Y3_PROM1 Phage integrase family OS=Prochlorococcus
marinus (strain NATL1A) GN=NATL1_05811 PE=4 SV=1
Length = 386

Score = 33.9 bits (76), Expect = 4.2
Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 5/89 (5%)
Frame = +3

Query: 36 KKQASSDLKTIPTSIHLPVNTIQT-IFNS*SKGKEDKRLLPITTEA----M*RLLGSSGK 200
K++A S KT T I + + + F+ S+ K ++ A + RL+G S K
Sbjct: 87 KEKALSSTKTNKTVISNEIESFKRQFFSDTSRSKSSAGMISTWQSAYKPYLNRLIGVSHK 146

Query: 201 PCLSMLPSLYIRLMLSYKKKHLSRYNVGM 287
L + L ++++LSYK+ SR G+
Sbjct: 147 STLKLSEELLVKILLSYKENSRSRQQCGI 175