BP915951
Clone id YMU001_000079_H09
Library
Length 505
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000079_H09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AAGGCAAAAGGCGAGGTATATCCATGTTGCAGAGGTGTATATCCTCTTGCTGTGTCACTT
GAAAAGTCATGCTGCTGCCTAATTGGAGGATAGACAGGAGGAGGGCCTAGTGTATTTTGA
GCGGTTTCTGGCTGAACTGGCATAGGCAACCCATACTCTTGAGAATATGAAGGTGTATAA
TTTCGGGCAAGGTCAGTATATTCATGCGTCGGATTCCGTGAAGGAGCTGAATGAATCATT
CCTGGATTTCCATGAGAAGAATTGTGAAACCCTGTTTTGTCACCAAGCGCTGAACTGGAA
AACTGACCTGGACGCCCGGGAAAGTTGTTTCCATAGGTTCTATCTGCCTCACTGTTACTA
TTCAAGTAAGCATTACTAGTAGGGGTGGTGACAGATGGCCTCAGAGATGGACTCACTCCA
GCAAATGCAGGAAATTGCACAGCACCATGATTGTGAAACCGAAAAGGTTCACTGGAAGAT
CCATAGTTTCCAGTTGCCTGCACGC
■■Homology search results ■■ -
sp_hit_id P24928
Definition sp|P24928|RPB1_HUMAN DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens
Align length 146
Score (bit) 40.8
E-value 0.004
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915951|Adiantum capillus-veneris mRNA, clone:
YMU001_000079_H09.
(505 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P24928|RPB1_HUMAN DNA-directed RNA polymerase II subunit RPB1... 41 0.004
sp|P11414|RPB1_CRIGR DNA-directed RNA polymerase II subunit RPB1... 41 0.004
sp|P08775|RPB1_MOUSE DNA-directed RNA polymerase II subunit RPB1... 40 0.008
sp|P04050|RPB1_YEAST DNA-directed RNA polymerase II subunit RPB1... 38 0.030
sp|P18616|RPB1_ARATH DNA-directed RNA polymerase II subunit RPB1... 38 0.030
sp|Q148V8|FA83H_MOUSE Protein FAM83H OS=Mus musculus GN=Fam83h P... 37 0.052
sp|O13598|YNI8_SCHPO WW domain-containing protein C11B10.08 OS=S... 37 0.068
sp|P35074|RPB1_CAEBR DNA-directed RNA polymerase II subunit RPB1... 37 0.068
sp|Q5AHB1|PAN1_CANAL Actin cytoskeleton-regulatory complex prote... 36 0.12
sp|Q9SFU0|SC24A_ARATH Protein transport protein Sec24-like At3g0... 35 0.20
sp|Q75A30|SEC31_ASHGO Protein transport protein SEC31 OS=Ashbya ... 35 0.26
sp|Q54UP9|ELMOD_DICDI Ankyrin repeat and ELMO domain-containing ... 34 0.34
sp|P07856|SERI1_BOMMO Sericin 1 OS=Bombyx mori GN=ser1 PE=1 SV=2 34 0.44
sp|P16356|RPB1_CAEEL DNA-directed RNA polymerase II subunit RPB1... 34 0.44
sp|Q01778|HUNB_MUSDO Protein hunchback OS=Musca domestica GN=hb ... 34 0.44
sp|P98072|ENTK_BOVIN Enteropeptidase OS=Bos taurus GN=PRSS7 PE=1... 33 0.58
sp|Q8IN94|OSA_DROME Trithorax group protein osa OS=Drosophila me... 33 0.75
sp|P56432|JUN_PIG Transcription factor AP-1 OS=Sus scrofa GN=JUN... 33 0.75
sp|Q9NYB9|ABI2_HUMAN Abl interactor 2 OS=Homo sapiens GN=ABI2 PE... 33 0.75
sp|A0JC51|ZIC4_XENLA Zinc finger protein ZIC 4 OS=Xenopus laevis... 33 0.98
sp|Q5SW25|PO122_MOUSE POM121-like protein 2 OS=Mus musculus GN=P... 33 0.98
sp|P32018|COEA1_CHICK Collagen alpha-1(XIV) chain OS=Gallus gall... 33 0.98
sp|Q9Y2J4|AMOL2_HUMAN Angiomotin-like protein 2 OS=Homo sapiens ... 33 0.98
sp|P04052|RPB1_DROME DNA-directed RNA polymerase II subunit RPB1... 32 1.3
sp|P46821|MAP1B_HUMAN Microtubule-associated protein 1B OS=Homo ... 32 1.3
sp|A7M7C7|CORL2_MOUSE Ladybird homeobox corepressor 1-like prote... 32 1.3
sp|B1AY13|UBP24_MOUSE Ubiquitin carboxyl-terminal hydrolase 24 O... 32 1.7
sp|Q8MML5|PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum GN=p... 32 1.7
sp|A7EKZ0|PAN1_SCLS1 Actin cytoskeleton-regulatory complex prote... 32 1.7
sp|Q09801|FIP1X_SCHPO Pre-mRNA polyadenylation factor fip1 OS=Sc... 32 1.7

>sp|P24928|RPB1_HUMAN DNA-directed RNA polymerase II subunit RPB1
OS=Homo sapiens GN=POLR2A PE=1 SV=1
Length = 1970

Score = 40.8 bits (94), Expect = 0.004
Identities = 41/146 (28%), Positives = 59/146 (40%), Gaps = 5/146 (3%)
Frame = -3

Query: 431 PAFAGVSPSLRPSVT--TPTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNS 258
P+++ SPS P+ TPTS +Y S+ E T P P +S T
Sbjct: 1823 PSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPT----- 1877

Query: 257 SHGNPGMIHSAPSRNPTHE-YTDLARNYTPSYSQEYGLPMPVQPETAQNTLGPPPVYPPI 81
+P + P +PT Y+ + YTP+ S +Y P T+ P Y P
Sbjct: 1878 ---SPTYSPTTPKYSPTSPTYSPTSPVYTPT-SPKYSPTSPTYSPTSPKYSPTSPTYSPT 1933

Query: 80 RQQHDFSSDTARGYTPLQHGY--TSP 9
+ S T+ GY+P Y TSP
Sbjct: 1934 SPKGSTYSPTSPGYSPTSPTYSLTSP 1959



Score = 39.7 bits (91), Expect = 0.008
Identities = 37/142 (26%), Positives = 61/142 (42%), Gaps = 3/142 (2%)
Frame = -3

Query: 431 PAFAGVSPSLRPSVTT--PTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNS 258
P+++ SPS P+ + PTS +Y ++ T + P P +S T +
Sbjct: 1641 PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS-PSY 1699

Query: 257 SHGNPGMIHSAPSRNPTH-EYTDLARNYTPSYSQEYGLPMPVQPETAQNTLGPPPVYPPI 81
S +P ++PS +PT Y+ + +Y+P+ S Y P T+ N P Y P
Sbjct: 1700 SPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT-SPSYSPTSPSYSPTSPNYSPTSPNYTPT 1758

Query: 80 RQQHDFSSDTARGYTPLQHGYT 15
+ S T+ Y+P YT
Sbjct: 1759 SPSY---SPTSPSYSPTSPNYT 1777



Score = 38.1 bits (87), Expect = 0.023
Identities = 36/142 (25%), Positives = 61/142 (42%), Gaps = 3/142 (2%)
Frame = -3

Query: 431 PAFAGVSPSLRPSVT--TPTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNS 258
P+++ SPS P+ +PTS +Y ++ T + P P +S T +
Sbjct: 1620 PSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS-PSY 1678

Query: 257 SHGNPGMIHSAPSRNPTH-EYTDLARNYTPSYSQEYGLPMPVQPETAQNTLGPPPVYPPI 81
S +P ++PS +PT Y+ + +Y+P+ S Y P T+ + P Y P
Sbjct: 1679 SPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT-SPSYSPTSPSYSPTSPSYSPTSPSYSPT 1737

Query: 80 RQQHDFSSDTARGYTPLQHGYT 15
+ S T+ Y+P YT
Sbjct: 1738 SPSY---SPTSPNYSPTSPNYT 1756


>sp|P11414|RPB1_CRIGR DNA-directed RNA polymerase II subunit RPB1
(Fragment) OS=Cricetulus griseus GN=POLR2A PE=3 SV=1
Length = 467

Score = 40.8 bits (94), Expect = 0.004
Identities = 41/146 (28%), Positives = 59/146 (40%), Gaps = 5/146 (3%)
Frame = -3

Query: 431 PAFAGVSPSLRPSVT--TPTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNS 258
P+++ SPS P+ TPTS +Y S+ E T P P +S T
Sbjct: 320 PSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPT----- 374

Query: 257 SHGNPGMIHSAPSRNPTHE-YTDLARNYTPSYSQEYGLPMPVQPETAQNTLGPPPVYPPI 81
+P + P +PT Y+ + YTP+ S +Y P T+ P Y P
Sbjct: 375 ---SPTYSPTTPKYSPTSPTYSPTSPVYTPT-SPKYSPTSPTYSPTSPKYSPTSPTYSPT 430

Query: 80 RQQHDFSSDTARGYTPLQHGY--TSP 9
+ S T+ GY+P Y TSP
Sbjct: 431 SPKGSTYSPTSPGYSPTSPTYSLTSP 456



Score = 39.7 bits (91), Expect = 0.008
Identities = 37/142 (26%), Positives = 61/142 (42%), Gaps = 3/142 (2%)
Frame = -3

Query: 431 PAFAGVSPSLRPSVTT--PTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNS 258
P+++ SPS P+ + PTS +Y ++ T + P P +S T +
Sbjct: 138 PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS-PSY 196

Query: 257 SHGNPGMIHSAPSRNPTH-EYTDLARNYTPSYSQEYGLPMPVQPETAQNTLGPPPVYPPI 81
S +P ++PS +PT Y+ + +Y+P+ S Y P T+ N P Y P
Sbjct: 197 SPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT-SPSYSPTSPSYSPTSPNYSPTSPNYTPT 255

Query: 80 RQQHDFSSDTARGYTPLQHGYT 15
+ S T+ Y+P YT
Sbjct: 256 SPSY---SPTSPSYSPTSPNYT 274



Score = 38.1 bits (87), Expect = 0.023
Identities = 36/142 (25%), Positives = 61/142 (42%), Gaps = 3/142 (2%)
Frame = -3

Query: 431 PAFAGVSPSLRPSVT--TPTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNS 258
P+++ SPS P+ +PTS +Y ++ T + P P +S T +
Sbjct: 117 PSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS-PSY 175

Query: 257 SHGNPGMIHSAPSRNPTH-EYTDLARNYTPSYSQEYGLPMPVQPETAQNTLGPPPVYPPI 81
S +P ++PS +PT Y+ + +Y+P+ S Y P T+ + P Y P
Sbjct: 176 SPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT-SPSYSPTSPSYSPTSPSYSPTSPSYSPT 234

Query: 80 RQQHDFSSDTARGYTPLQHGYT 15
+ S T+ Y+P YT
Sbjct: 235 SPSY---SPTSPNYSPTSPNYT 253


>sp|P08775|RPB1_MOUSE DNA-directed RNA polymerase II subunit RPB1
OS=Mus musculus GN=Polr2a PE=1 SV=3
Length = 1970

Score = 39.7 bits (91), Expect = 0.008
Identities = 37/142 (26%), Positives = 61/142 (42%), Gaps = 3/142 (2%)
Frame = -3

Query: 431 PAFAGVSPSLRPSVTT--PTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNS 258
P+++ SPS P+ + PTS +Y ++ T + P P +S T +
Sbjct: 1641 PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS-PSY 1699

Query: 257 SHGNPGMIHSAPSRNPTH-EYTDLARNYTPSYSQEYGLPMPVQPETAQNTLGPPPVYPPI 81
S +P ++PS +PT Y+ + +Y+P+ S Y P T+ N P Y P
Sbjct: 1700 SPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT-SPSYSPTSPSYSPTSPNYSPTSPNYTPT 1758

Query: 80 RQQHDFSSDTARGYTPLQHGYT 15
+ S T+ Y+P YT
Sbjct: 1759 SPSY---SPTSPSYSPTSPNYT 1777



Score = 38.9 bits (89), Expect = 0.014
Identities = 40/146 (27%), Positives = 58/146 (39%), Gaps = 5/146 (3%)
Frame = -3

Query: 431 PAFAGVSPSLRPSVT--TPTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNS 258
P+++ SPS P+ TPTS +Y S+ E P P +S T
Sbjct: 1823 PSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPASPKYSPTSPKYSPTSPKYSPT----- 1877

Query: 257 SHGNPGMIHSAPSRNPTHE-YTDLARNYTPSYSQEYGLPMPVQPETAQNTLGPPPVYPPI 81
+P + P +PT Y+ + YTP+ S +Y P T+ P Y P
Sbjct: 1878 ---SPTYSPTTPKYSPTSPTYSPTSPVYTPT-SPKYSPTSPTYSPTSPKYSPTSPTYSPT 1933

Query: 80 RQQHDFSSDTARGYTPLQHGY--TSP 9
+ S T+ GY+P Y TSP
Sbjct: 1934 SPKGSTYSPTSPGYSPTSPTYSLTSP 1959



Score = 38.1 bits (87), Expect = 0.023
Identities = 36/142 (25%), Positives = 61/142 (42%), Gaps = 3/142 (2%)
Frame = -3

Query: 431 PAFAGVSPSLRPSVT--TPTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNS 258
P+++ SPS P+ +PTS +Y ++ T + P P +S T +
Sbjct: 1620 PSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS-PSY 1678

Query: 257 SHGNPGMIHSAPSRNPTH-EYTDLARNYTPSYSQEYGLPMPVQPETAQNTLGPPPVYPPI 81
S +P ++PS +PT Y+ + +Y+P+ S Y P T+ + P Y P
Sbjct: 1679 SPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT-SPSYSPTSPSYSPTSPSYSPTSPSYSPT 1737

Query: 80 RQQHDFSSDTARGYTPLQHGYT 15
+ S T+ Y+P YT
Sbjct: 1738 SPSY---SPTSPNYSPTSPNYT 1756


>sp|P04050|RPB1_YEAST DNA-directed RNA polymerase II subunit RPB1
OS=Saccharomyces cerevisiae GN=RPB1 PE=1 SV=2
Length = 1733

Score = 37.7 bits (86), Expect = 0.030
Identities = 36/142 (25%), Positives = 61/142 (42%), Gaps = 3/142 (2%)
Frame = -3

Query: 431 PAFAGVSPSLRPSVTT--PTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNS 258
P+++ SPS P+ + PTS +Y ++ T + P P +S T +
Sbjct: 1575 PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS-PSY 1633

Query: 257 SHGNPGMIHSAPSRNPTH-EYTDLARNYTPSYSQEYGLPMPVQPETAQNTLGPPPVYPPI 81
S +P ++PS +PT Y+ + Y+P+ S Y P T+ + P Y P
Sbjct: 1634 SPTSPSYSPTSPSYSPTSPSYSPTSPAYSPT-SPSYSPTSPSYSPTSPSYSPTSPSYSPT 1692

Query: 80 RQQHDFSSDTARGYTPLQHGYT 15
+ S T+ Y+P GY+
Sbjct: 1693 SPNY---SPTSPSYSPTSPGYS 1711


>sp|P18616|RPB1_ARATH DNA-directed RNA polymerase II subunit RPB1
OS=Arabidopsis thaliana GN=RPB205 PE=1 SV=2
Length = 1840

Score = 37.7 bits (86), Expect = 0.030
Identities = 39/146 (26%), Positives = 62/146 (42%), Gaps = 5/146 (3%)
Frame = -3

Query: 431 PAFAGVSPSLRPSVT--TPTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNS 258
P ++ SP+ PS +PTS AY ++ T + P P +S T +
Sbjct: 1571 PGYSPTSPTYSPSSPGYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS-PSY 1629

Query: 257 SHGNPGMIHSAPSRNPTHE-YTDLARNYTPSYSQEYGLPMPVQPETAQNTLGPPPVYPPI 81
S +P ++P+ +PT Y+ + Y+P+ S Y P T+ + P Y P
Sbjct: 1630 SPTSPSYSPTSPAYSPTSPAYSPTSPAYSPT-SPSYSPTSPSYSPTSPSYSPTSPSYSPT 1688

Query: 80 RQQHDFSSDTARGYTPLQHGY--TSP 9
+ S T+ Y+P GY TSP
Sbjct: 1689 SPSY---SPTSPAYSPTSPGYSPTSP 1711



Score = 30.8 bits (68), Expect = 3.7
Identities = 23/93 (24%), Positives = 39/93 (41%)
Frame = -3

Query: 431 PAFAGVSPSLRPSVTTPTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNSSH 252
P++ S PS+ SNA L+ S T N P P +S ++ S
Sbjct: 1725 PSYNPQSAKYSPSIAYSPSNARLSPASPYSPTSPNYSPTSP-SYSPTSPSYSPSSPTYSP 1783

Query: 251 GNPGMIHSAPSRNPTHEYTDLARNYTPSYSQEY 153
+P ++P +P+ Y+ Y+PS + +Y
Sbjct: 1784 SSPYSSGASPDYSPSAGYSPTLPGYSPSSTGQY 1816


>sp|Q148V8|FA83H_MOUSE Protein FAM83H OS=Mus musculus GN=Fam83h PE=1
SV=1
Length = 1209

Score = 37.0 bits (84), Expect = 0.052
Identities = 19/55 (34%), Positives = 26/55 (47%)
Frame = -3

Query: 251 GNPGMIHSAPSRNPTHEYTDLARNYTPSYSQEYGLPMPVQPETAQNTLGPPPVYP 87
G + +S P NPT Y + + TP+Y + G P P PE + P P YP
Sbjct: 848 GTHQLPYSEPKGNPTPAYPERKGSPTPAYPERKGSPTPAYPERKGS---PTPAYP 899



Score = 32.0 bits (71), Expect = 1.7
Identities = 17/60 (28%), Positives = 26/60 (43%)
Frame = -3

Query: 266 HNSSHGNPGMIHSAPSRNPTHEYTDLARNYTPSYSQEYGLPMPVQPETAQNTLGPPPVYP 87
++ GNP + +PT Y + + TP+Y + G P P PE + P YP
Sbjct: 854 YSEPKGNPTPAYPERKGSPTPAYPERKGSPTPAYPERKGSPTPAYPERKGS---PTQAYP 910


>sp|O13598|YNI8_SCHPO WW domain-containing protein C11B10.08
OS=Schizosaccharomyces pombe GN=SPBC11B10.08 PE=2 SV=1
Length = 204

Score = 36.6 bits (83), Expect = 0.068
Identities = 26/83 (31%), Positives = 32/83 (38%), Gaps = 4/83 (4%)
Frame = -3

Query: 245 PGMIHSAPSRNPTHEYTDLARNYTPSYSQEYGLPMPVQPETAQNTL--GPPPVYPPI--R 78
P + HSAP P Y++ A TP+ S P P P +QN P YPP
Sbjct: 51 PSVDHSAPPSGPPPSYSNSAAPATPAASASSAAPAPA-PAASQNRAYGAAPQPYPPQGGY 109

Query: 77 QQHDFSSDTARGYTPLQHGYTSP 9
Q + Y P Q Y P
Sbjct: 110 PQQPYYYPNQPNYYPAQPAYAQP 132


>sp|P35074|RPB1_CAEBR DNA-directed RNA polymerase II subunit RPB1
OS=Caenorhabditis briggsae GN=ama-1 PE=3 SV=2
Length = 1853

Score = 36.6 bits (83), Expect = 0.068
Identities = 41/147 (27%), Positives = 62/147 (42%), Gaps = 4/147 (2%)
Frame = -3

Query: 431 PAFAGVSPSLRPSVTT--PTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNS 258
P+++ SPS P+ + PTS +Y ++ T + P P +S T
Sbjct: 1635 PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPSSPRYSPTSPTYSPTS-PTY 1693

Query: 257 SHGNPGMIHSAPSRNPTHEYTDLARNYTPSYSQEYGLPMPVQPETAQNTLGPPPVYPPIR 78
S +P ++P+ +PT + Y+PS S +Y P T+ + P Y P
Sbjct: 1694 SPTSPTYSPTSPTYSPTSPSYE---GYSPS-SPKYSPSSPTYSPTSPSYSPTSPQYSPTS 1749

Query: 77 QQHDFSSDTARGYTPLQHGY--TSPFA 3
Q+ SS T YTP Y TSP A
Sbjct: 1750 PQYSPSSPT---YTPSSPTYNPTSPRA 1773



Score = 36.2 bits (82), Expect = 0.089
Identities = 34/145 (23%), Positives = 57/145 (39%), Gaps = 6/145 (4%)
Frame = -3

Query: 431 PAFAGVSPSLRPSVT-----TPTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGF 267
P ++ SPS P+ +P S +Y ++ T + P P +S T
Sbjct: 1590 PHYSPTSPSYSPTSPAHHGQSPVSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT-- 1647

Query: 266 HNSSHGNPGMIHSAPSRNPTH-EYTDLARNYTPSYSQEYGLPMPVQPETAQNTLGPPPVY 90
+P ++PS +PT Y+ + +Y+PS S Y P T+ P Y
Sbjct: 1648 ------SPSYSPTSPSYSPTSPSYSPTSPSYSPS-SPRYSPTSPTYSPTSPTYSPTSPTY 1700

Query: 89 PPIRQQHDFSSDTARGYTPLQHGYT 15
P + +S + GY+P Y+
Sbjct: 1701 SPTSPTYSPTSPSYEGYSPSSPKYS 1725


>sp|Q5AHB1|PAN1_CANAL Actin cytoskeleton-regulatory complex protein
PAN1 OS=Candida albicans GN=PAN1 PE=3 SV=1
Length = 1397

Score = 35.8 bits (81), Expect = 0.12
Identities = 27/84 (32%), Positives = 33/84 (39%), Gaps = 5/84 (5%)
Frame = -3

Query: 320 PGRPGQFSSSALGDKTGFHNSSHGNPGMIHSAPSRNPTHEYTD-----LARNYTPSYSQE 156
P P SSS D H N + S P N + TD A S+SQ
Sbjct: 1225 PQPPTTSSSSLNNDAEKVSEQEHENAKQVASTPLSNDDNGKTDSGPSGFAGENESSFSQ- 1283

Query: 155 YGLPMPVQPETAQNTLGPPPVYPP 84
P+PV A N++ PPP PP
Sbjct: 1284 -APPIPVDAPPAPNSIPPPPPPPP 1306


>sp|Q9SFU0|SC24A_ARATH Protein transport protein Sec24-like
At3g07100 OS=Arabidopsis thaliana GN=At3g07100 PE=1 SV=2
Length = 1038

Score = 35.0 bits (79), Expect = 0.20
Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 2/80 (2%)
Frame = -3

Query: 317 GRPGQFSSSALGDKTGFHNSSHGNPGMIHSAPSRNPTHEYTDLARNYTPSYSQEYGLPMP 138
G PG ++A T +H + PG S P P++ ++ P Y + L P
Sbjct: 165 GLPG---ANAYPPATDYHMPAR--PGFQQSMPPVTPSYPGVGGSQPSFPGYPSKQVLQAP 219

Query: 137 VQPETAQNTLGPPPV--YPP 84
+T+Q GPPPV YPP
Sbjct: 220 TPFQTSQGPPGPPPVSSYPP 239


tr_hit_id B0XAQ9
Definition tr|B0XAQ9|B0XAQ9_CULQU DNA-directed RNA polymerase OS=Culex quinquefasciatus
Align length 167
Score (bit) 47.4
E-value 0.0004
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915951|Adiantum capillus-veneris mRNA, clone:
YMU001_000079_H09.
(505 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B0XAQ9|B0XAQ9_CULQU DNA-directed RNA polymerase OS=Culex quin... 47 4e-04
tr|Q4P477|Q4P477_USTMA Putative uncharacterized protein OS=Ustil... 43 0.007
tr|Q6FQS9|Q6FQS9_CANGA DNA-directed RNA polymerase OS=Candida gl... 43 0.010
tr|Q7Q3C6|Q7Q3C6_ANOGA DNA-directed RNA polymerase (Fragment) OS... 42 0.013
tr|B7PJA3|B7PJA3_IXOSC DNA-directed RNA polymerase II largest su... 42 0.013
tr|B6MVD8|B6MVD8_BRAFL Putative uncharacterized protein OS=Branc... 42 0.021
tr|A7S8F9|A7S8F9_NEMVE DNA-directed RNA polymerase OS=Nematostel... 42 0.021
tr|B4E3V7|B4E3V7_HUMAN cDNA FLJ61585, highly similar to DNA-dire... 42 0.021
tr|Q58EF0|Q58EF0_DANRE Im:7136071 protein (Fragment) OS=Danio re... 41 0.028
tr|A8PU11|A8PU11_BRUMA DNA-directed RNA polymerase OS=Brugia mal... 41 0.028
tr|Q76M93|Q76M93_CRIGR DNA-directed RNA polymerase OS=Cricetulus... 41 0.037
tr|O35559|O35559_CRIGR DNA-directed RNA polymerase OS=Cricetulus... 41 0.037
tr|B8A0M3|B8A0M3_MAIZE Putative uncharacterized protein OS=Zea m... 41 0.037
tr|B7G9I2|B7G9I2_PHATR Predicted protein (Fragment) OS=Phaeodact... 41 0.037
tr|B4FWM3|B4FWM3_MAIZE Putative uncharacterized protein OS=Zea m... 41 0.037
tr|Q7RNH3|Q7RNH3_PLAYO Maebl OS=Plasmodium yoelii yoelii GN=PY01... 41 0.037
tr|A6NN93|A6NN93_HUMAN DNA-directed RNA polymerase OS=Homo sapie... 41 0.037
tr|A4RDN8|A4RDN8_MAGGR Putative uncharacterized protein OS=Magna... 40 0.048
tr|B0WC16|B0WC16_CULQU Putative uncharacterized protein OS=Culex... 40 0.062
tr|Q5ACI7|Q5ACI7_CANAL DNA-directed RNA polymerase OS=Candida al... 40 0.062
tr|A8N1F7|A8N1F7_COPC7 Putative uncharacterized protein OS=Copri... 40 0.062
tr|Q5F298|Q5F298_MOUSE DNA-directed RNA polymerase OS=Mus muscul... 40 0.081
tr|O08847|O08847_MOUSE DNA-directed RNA polymerase OS=Mus muscul... 40 0.081
tr|B4DET1|B4DET1_HUMAN cDNA FLJ53860, highly similar to DNA-dire... 40 0.081
tr|Q0DKN9|Q0DKN9_ORYSJ DNA-directed RNA polymerase OS=Oryza sati... 39 0.14
tr|Q6CUH7|Q6CUH7_KLULA KLLA0C04774p OS=Kluyveromyces lactis GN=K... 39 0.14
tr|A3B018|A3B018_ORYSJ DNA-directed RNA polymerase OS=Oryza sati... 39 0.18
tr|Q7QBY9|Q7QBY9_ANOGA AGAP002367-PA (Fragment) OS=Anopheles gam... 39 0.18
tr|B4FGX3|B4FGX3_MAIZE Putative uncharacterized protein OS=Zea m... 38 0.24
tr|A9U396|A9U396_PHYPA DNA-directed RNA polymerase OS=Physcomitr... 38 0.24

>tr|B0XAQ9|B0XAQ9_CULQU DNA-directed RNA polymerase OS=Culex
quinquefasciatus GN=CpipJ_CPIJ016666 PE=3 SV=1
Length = 1874

Score = 47.4 bits (111), Expect = 4e-04
Identities = 45/167 (26%), Positives = 70/167 (41%), Gaps = 4/167 (2%)
Frame = -3

Query: 497 ATGNYGSSSEPFRFHNHGAVQFPAFAGVSPSLRPSVT--TPTSNAYLNSNSEADRTYGNN 324
A+ +Y SS + + G P ++ SPS P+ +PTS Y ++ T N
Sbjct: 1556 ASPSYSPSSPNYAAASPGGAS-PGYSPTSPSYSPTSPNYSPTSPRYSPTSPNYSPTSPNY 1614

Query: 323 FPGRPGQFSSSALGDKTGFHNSSHGNPGMIHSAPSRNPTHEYTDLARNYTPSYSQEYGLP 144
P P +S L T + S +P ++PS +PT Y+ + +Y+P+ S Y
Sbjct: 1615 SPTSPSYSPTSPLYSPTATYAPS--SPAYSPTSPSYSPTSPYSPTSPSYSPT-SPAYS-- 1669

Query: 143 MPVQPETAQNTLGPPPVYPPIRQQHDFSSDTARGYTPLQHGY--TSP 9
P P + ++ P P S T+ YTP Y TSP
Sbjct: 1670 -PTSPSYSPSSPSYSPTSPSYSPTSPSYSPTSPNYTPATPSYSPTSP 1715



Score = 39.3 bits (90), Expect = 0.11
Identities = 39/152 (25%), Positives = 63/152 (41%), Gaps = 14/152 (9%)
Frame = -3

Query: 431 PAFAGVSPSLRPSVT--TPTSNAYLNSNSEADRTYGNNFPGRPG--QFS---------SS 291
P ++ SPS PS +PTS +Y S +YG + P Q+S S
Sbjct: 1722 PHYSPTSPSYSPSSPKYSPTSPSY----SPTSPSYGGSPQYTPASPQYSPTSPKYSPTSP 1777

Query: 290 ALGDKTGFHNSSHGNPGMIHSAPSRNPTH-EYTDLARNYTPSYSQEYGLPMPVQPETAQN 114
+ + H+ + ++P+ +PT Y+ +Y+P SQ+Y PV T+ +
Sbjct: 1778 SYSPSSPQHSPGSSGSNFMVNSPTYSPTTARYSPNMSSYSPG-SQKYSPTSPVYTPTSPH 1836

Query: 113 TLGPPPVYPPIRQQHDFSSDTARGYTPLQHGY 18
P Y P Q + SS + Y+P Y
Sbjct: 1837 YSPSSPAYSPTGQGYSPSSPASPTYSPTSPSY 1868



Score = 33.1 bits (74), Expect = 7.6
Identities = 39/163 (23%), Positives = 62/163 (38%), Gaps = 18/163 (11%)
Frame = -3

Query: 437 QFPAFAGVSPSLRPSVTTPTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNS 258
Q P + SPS PS TP ++ S ++ PG SS F +S
Sbjct: 1494 QTPGYGEWSPSGPPSGMTPGGPSFSPSAQSDASGMSPSWSPMPGSPSSPGPSMSPYFPSS 1553

Query: 257 SHGNPGMIHSAPS------------RNPTH-EYTDLARNYTPSYSQEYGLPMPVQPETAQ 117
+P S+P+ +PT Y+ + NY+P+ S Y P T+
Sbjct: 1554 PSASPSYSPSSPNYAAASPGGASPGYSPTSPSYSPTSPNYSPT-SPRYSPTSPNYSPTSP 1612

Query: 116 NTLGPPPVYPPIRQQHDFS---SDTARGYTPLQHGY--TSPFA 3
N P Y P + + + ++ Y+P Y TSP++
Sbjct: 1613 NYSPTSPSYSPTSPLYSPTATYAPSSPAYSPTSPSYSPTSPYS 1655


>tr|Q4P477|Q4P477_USTMA Putative uncharacterized protein OS=Ustilago
maydis GN=UM05086.1 PE=4 SV=1
Length = 1834

Score = 43.1 bits (100), Expect = 0.007
Identities = 30/99 (30%), Positives = 39/99 (39%), Gaps = 14/99 (14%)
Frame = -3

Query: 338 TYGNNFPGRPGQFSSS-------ALGDKTGFHNSSHGNPGMIHSAPSRNPTHEYTDLARN 180
+YGN + G P +++ A G+ +S HG+ H+ P PTH Y
Sbjct: 1707 SYGNGYSGSPSGANAAYPPSYYPASASSGGYGSSGHGHGHGYHAPPPPPPTHHYGAGREP 1766

Query: 179 YTPSYSQEYGLPMPVQPET-------AQNTLGPPPVYPP 84
Y SY G P E A TL PPP PP
Sbjct: 1767 YPSSYPDRRGSPYREGRERDYRDGRYAHPTLPPPPPPPP 1805


>tr|Q6FQS9|Q6FQS9_CANGA DNA-directed RNA polymerase OS=Candida
glabrata GN=CAGL0I03828g PE=3 SV=1
Length = 1715

Score = 42.7 bits (99), Expect = 0.010
Identities = 44/171 (25%), Positives = 71/171 (41%), Gaps = 12/171 (7%)
Frame = -3

Query: 485 YGSSSEPFRFHNH-------GAVQFPAFAGVSPSLRPSVT--TPTSNAYLNSNSEADRTY 333
YG ++ PF + G V P F+ SP+ P+ +PTS +Y ++ T
Sbjct: 1516 YGGATSPFGAYGDAPASPGFGGVSSPGFSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTS 1575

Query: 332 GNNFPGRPGQFSSSALGDKTGFHNSSHGNPGMIHSAPSRNPTH-EYTDLARNYTPSYSQE 156
+ P P +S T + S +P ++PS +PT Y+ + +Y+P+ S
Sbjct: 1576 PSYSPTSPSYSPTSPSYSPTS-PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT-SPS 1633

Query: 155 YGLPMPVQPETAQNTLGPPPVYPPIRQQHDFSSDTARGYTPLQHGY--TSP 9
Y P T+ + P Y P + S T+ Y+P Y TSP
Sbjct: 1634 YSPTSPSYSPTSPSYSPTSPSYSPTSPSY---SPTSPSYSPTSPSYSPTSP 1681


>tr|Q7Q3C6|Q7Q3C6_ANOGA DNA-directed RNA polymerase (Fragment)
OS=Anopheles gambiae GN=AGAP007810 PE=3 SV=3
Length = 1878

Score = 42.4 bits (98), Expect = 0.013
Identities = 47/174 (27%), Positives = 71/174 (40%), Gaps = 19/174 (10%)
Frame = -3

Query: 497 ATGNYGSSSEPFR----FHNHGAVQF---------PAFAGVSPSLRPS--VTTPTSNAYL 363
AT NY +S + H A F P+++ SPS PS V +PTS +Y
Sbjct: 1621 ATQNYSPTSPSYSPMSPMHPTSASNFASPGYSPTSPSYSPTSPSYSPSSPVFSPTSPSYS 1680

Query: 362 NSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNSSHGNPGMIHSAPSRNPTH-EYTDLA 186
S+ T + P P +S N + P S+P+ +PT Y+ +
Sbjct: 1681 PSSPSYSPTSPSYSPTSPSYSPTSP--------NFTPVTPSYSPSSPNYSPTSPHYSPAS 1732

Query: 185 RNYTPSYSQEYGLPMPVQPETAQNTLGPP---PVYPPIRQQHDFSSDTARGYTP 33
+Y+PS S +Y P T+ + +G P P P Q S T+ Y+P
Sbjct: 1733 PSYSPS-SPKYSPTSPSYSPTSPSYIGSPHYTPASPQYGQASPNYSPTSPSYSP 1785



Score = 37.4 bits (85), Expect = 0.40
Identities = 37/148 (25%), Positives = 60/148 (40%), Gaps = 4/148 (2%)
Frame = -3

Query: 449 HGAVQFPAFAGVSPSLRPSVTT--PTSNAYLNSN--SEADRTYGNNFPGRPGQFSSSALG 282
H + P+++ SP P+ + PTS +Y+ S + A YG P S +
Sbjct: 1727 HYSPASPSYSPSSPKYSPTSPSYSPTSPSYIGSPHYTPASPQYGQASPNYSPTSPSYSPS 1786

Query: 281 DKTGFHNSSHGNPGMIHSAPSRNPTHEYTDLARNYTPSYSQEYGLPMPVQPETAQNTLGP 102
SS + + S+ S+ P Y+ +Y+PS S +Y PV ++
Sbjct: 1787 SPQHSPGSSSNHYSIGSSSYSQTPA-PYSPNMSSYSPS-SPKYSPTSPVYTSSSPTYSPS 1844

Query: 101 PPVYPPIRQQHDFSSDTARGYTPLQHGY 18
P Y P Q + SS + Y+P Y
Sbjct: 1845 SPAYSPTPQGYSPSSPASPTYSPTSPSY 1872


>tr|B7PJA3|B7PJA3_IXOSC DNA-directed RNA polymerase II largest
subunit, putative (Fragment) OS=Ixodes scapularis
GN=IscW_ISCW004607 PE=4 SV=1
Length = 1937

Score = 42.4 bits (98), Expect = 0.013
Identities = 39/142 (27%), Positives = 60/142 (42%), Gaps = 3/142 (2%)
Frame = -3

Query: 431 PAFAGVSPSLRPSVTT--PTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNS 258
PA+A SPS+ P+ T PTS +Y ++ T N P P +S T
Sbjct: 1598 PAYAPSSPSMTPASPTYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPT----- 1652

Query: 257 SHGNPGMIHSAPSRNPTH-EYTDLARNYTPSYSQEYGLPMPVQPETAQNTLGPPPVYPPI 81
+P ++PS +PT Y+ + +Y+P+ S Y P T+ + P Y P
Sbjct: 1653 ---SPSYSPTSPSYSPTSPSYSPTSPSYSPT-SPSYSPTSPSYSPTSPSYSPTSPSYSPT 1708

Query: 80 RQQHDFSSDTARGYTPLQHGYT 15
+ S T+ Y+P YT
Sbjct: 1709 SPSY---SPTSPSYSPSSPNYT 1727



Score = 38.5 bits (88), Expect = 0.18
Identities = 37/146 (25%), Positives = 60/146 (41%), Gaps = 5/146 (3%)
Frame = -3

Query: 431 PAFAGVSPSLRPSVT--TPTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNS 258
P+++ SPS P TP+S Y ++ T + P P +S T
Sbjct: 1794 PSYSPTSPSYSPGSPQYTPSSPKYSPTSPTYSPTSPSYSPSSPKYSPTSPKYSPTS-PTY 1852

Query: 257 SHGNPGMIHSAPSRNPTH-EYTDLARNYTPSYSQEYGLPMPVQPETAQNTLGPPPVYPPI 81
+ +P ++P +PT +Y+ + Y+P+ S +Y P T+ P Y P
Sbjct: 1853 TPSSPKYSPTSPQYSPTSPQYSPTSPKYSPT-SPKYSPTSPTYSPTSPKYSPTSPTYSPT 1911

Query: 80 RQQHDFSSDTARGYTPLQHGY--TSP 9
+ S T+ GY+P Y TSP
Sbjct: 1912 SPKGSSYSPTSPGYSPSSPTYSPTSP 1937



Score = 33.1 bits (74), Expect = 7.6
Identities = 38/145 (26%), Positives = 58/145 (40%), Gaps = 7/145 (4%)
Frame = -3

Query: 422 AGVSPSLRP--SVTTPTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNSSHG 249
AG+SP + P TP+ + + + T PG G FS SA D +G+ +S G
Sbjct: 1511 AGMSPQMTPWGQGATPSYGSGWSPGLGSGMT-----PGAAG-FSPSAASDASGYSPASAG 1564

Query: 248 -NPGMIHS--APSRNPTHEYTDLARNYTPSYSQEYGLPMPVQPETAQNTLGPPPVYPPIR 78
+PG +P+ +P Y +P PV P + ++ P P +
Sbjct: 1565 LSPGWSPQPGSPASSPASPY----------------IPSPVSPNYSPSSPAYAPSSPSMT 1608

Query: 77 QQHDFSSDTARGYTPLQHGY--TSP 9
S T+ Y+P Y TSP
Sbjct: 1609 PASPTYSPTSPSYSPTSPSYSPTSP 1633


>tr|B6MVD8|B6MVD8_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_115025 PE=4 SV=1
Length = 1956

Score = 41.6 bits (96), Expect = 0.021
Identities = 38/149 (25%), Positives = 62/149 (41%), Gaps = 8/149 (5%)
Frame = -3

Query: 437 QFPAFAGVSPSLRPSVTTPTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNS 258
Q P+++ SPS PS P+S Y ++ + + P P ++S ++
Sbjct: 1793 QSPSYSPSSPSYSPSSPNPSSPKYTPTSPKYSPSSPKYSPSSP-KYSPTSPTYSPSSAKY 1851

Query: 257 SHGNPGMIHSAPSRNPTH-EYTDLARNYTPSYSQEYGLPMP-VQPETAQNTLGPP----- 99
S +P S P PT +Y+ + YTP+ S +Y P P+T + + P
Sbjct: 1852 SPASPSYSPSTPKYTPTSPKYSPASPTYTPT-SPKYSPTSPSYTPDTPKYSPTSPKYSPT 1910

Query: 98 -PVYPPIRQQHDFSSDTARGYTPLQHGYT 15
P Y P + S T GY+P Y+
Sbjct: 1911 SPTYSPTSPKGSTYSPTTPGYSPASPTYS 1939



Score = 37.0 bits (84), Expect = 0.53
Identities = 37/147 (25%), Positives = 60/147 (40%), Gaps = 6/147 (4%)
Frame = -3

Query: 431 PAFAGVSPSLRPSVTT--PTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNS 258
P+++ SPS P+ + PTS +Y ++ T + P P +S T +
Sbjct: 1669 PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS-PSY 1727

Query: 257 SHGNPGMIHSAPSRNPTH-EYTDLARNYTP---SYSQEYGLPMPVQPETAQNTLGPPPVY 90
S +P ++PS +PT YT + Y+P SYS P P + + P
Sbjct: 1728 SPTSPSYSPTSPSYSPTSPNYTPTSPKYSPTSPSYSPTSPSYSPASPSYSPTSPSYSPSS 1787

Query: 89 PPIRQQHDFSSDTARGYTPLQHGYTSP 9
P Q S ++ Y+P +SP
Sbjct: 1788 PNYSPQSPSYSPSSPSYSPSSPNPSSP 1814



Score = 36.6 bits (83), Expect = 0.69
Identities = 35/142 (24%), Positives = 59/142 (41%), Gaps = 3/142 (2%)
Frame = -3

Query: 431 PAFAGVSPSLRPSVT--TPTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNS 258
P+++ SPS P+ +PTS +Y ++ T + P P +S T
Sbjct: 1620 PSYSPTSPSYSPASPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT----- 1674

Query: 257 SHGNPGMIHSAPSRNPTH-EYTDLARNYTPSYSQEYGLPMPVQPETAQNTLGPPPVYPPI 81
+P ++PS +PT Y+ + +Y+P+ S Y P T+ + P Y P
Sbjct: 1675 ---SPSYSPTSPSYSPTSPSYSPTSPSYSPT-SPSYSPTSPSYSPTSPSYSPTSPSYSPT 1730

Query: 80 RQQHDFSSDTARGYTPLQHGYT 15
+ S T+ Y+P YT
Sbjct: 1731 SPSY---SPTSPSYSPTSPNYT 1749


>tr|A7S8F9|A7S8F9_NEMVE DNA-directed RNA polymerase OS=Nematostella
vectensis GN=v1g229643 PE=3 SV=1
Length = 1929

Score = 41.6 bits (96), Expect = 0.021
Identities = 37/142 (26%), Positives = 61/142 (42%), Gaps = 3/142 (2%)
Frame = -3

Query: 431 PAFAGVSPSLRPSVTT--PTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNS 258
P+++ SPS P+ + PTS +Y ++ T + P P SS +
Sbjct: 1725 PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPSSPSYSPSSPSYSPQSPSYA 1784

Query: 257 SHGNPGMIHSAPSRNPTH-EYTDLARNYTPSYSQEYGLPMPVQPETAQNTLGPPPVYPPI 81
S +P ++PS +PT +Y+ + NY+P+ S Y P T+ + P Y P
Sbjct: 1785 SPSSPKYSPASPSYSPTSPKYSPTSPNYSPA-SPSYSPSSPKYSPTSPSYTPASPSYSPA 1843

Query: 80 RQQHDFSSDTARGYTPLQHGYT 15
+ SS + Y+P YT
Sbjct: 1844 SPSYSPSSPS---YSPSSPRYT 1862


>tr|B4E3V7|B4E3V7_HUMAN cDNA FLJ61585, highly similar to DNA-directed
RNA polymerase II largest subunit (EC 2.7.7.6) OS=Homo
sapiens PE=2 SV=1
Length = 1935

Score = 41.6 bits (96), Expect = 0.021
Identities = 42/146 (28%), Positives = 58/146 (39%), Gaps = 5/146 (3%)
Frame = -3

Query: 431 PAFAGVSPSLRPSVT--TPTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNS 258
P+++ SPS P+ TPTS Y S+ E T P P +S TG
Sbjct: 1788 PSYSPSSPSYSPTSPKYTPTSPPYSPSSPEYTPTSPKFSPTSPKYSPTSPKYSPTG---- 1843

Query: 257 SHGNPGMIHSAPSRNPTHE-YTDLARNYTPSYSQEYGLPMPVQPETAQNTLGPPPVYPPI 81
P + P +PT Y+ + YTP+ S +Y P T+ P Y P
Sbjct: 1844 ----PTYSPTTPKYSPTSPTYSPTSPVYTPT-SPKYSPTSPTYSPTSPQYSPTSPTYSPT 1898

Query: 80 RQQHDFSSDTARGYTPLQHGY--TSP 9
+ S T+ GY+P Y TSP
Sbjct: 1899 SPKGSTYSPTSPGYSPTSPTYSLTSP 1924



Score = 39.7 bits (91), Expect = 0.081
Identities = 37/142 (26%), Positives = 61/142 (42%), Gaps = 3/142 (2%)
Frame = -3

Query: 431 PAFAGVSPSLRPSVTT--PTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNS 258
P+++ SPS P+ + PTS +Y ++ T + P P +S T +
Sbjct: 1606 PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS-PSY 1664

Query: 257 SHGNPGMIHSAPSRNPTH-EYTDLARNYTPSYSQEYGLPMPVQPETAQNTLGPPPVYPPI 81
S +P ++PS +PT Y+ + +Y+P+ S Y P T+ N P Y P
Sbjct: 1665 SPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT-SPSYSPTSPSYSPTSPNYSPTSPNYTPT 1723

Query: 80 RQQHDFSSDTARGYTPLQHGYT 15
+ S T+ Y+P YT
Sbjct: 1724 SPSY---SPTSPSYSPTSPNYT 1742



Score = 38.9 bits (89), Expect = 0.14
Identities = 36/142 (25%), Positives = 62/142 (43%), Gaps = 3/142 (2%)
Frame = -3

Query: 431 PAFAGVSPSLRPSVT--TPTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNS 258
P+++ SPS P+ + +PTS +Y ++ T + P P +S T +
Sbjct: 1585 PSYSPTSPSYSPTSSNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS-PSY 1643

Query: 257 SHGNPGMIHSAPSRNPTH-EYTDLARNYTPSYSQEYGLPMPVQPETAQNTLGPPPVYPPI 81
S +P ++PS +PT Y+ + +Y+P+ S Y P T+ + P Y P
Sbjct: 1644 SPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT-SPSYSPTSPSYSPTSPSYSPTSPSYSPT 1702

Query: 80 RQQHDFSSDTARGYTPLQHGYT 15
+ S T+ Y+P YT
Sbjct: 1703 SPSY---SPTSPNYSPTSPNYT 1721


>tr|Q58EF0|Q58EF0_DANRE Im:7136071 protein (Fragment) OS=Danio rerio
GN=polr2a PE=1 SV=1
Length = 161

Score = 41.2 bits (95), Expect = 0.028
Identities = 38/142 (26%), Positives = 57/142 (40%), Gaps = 3/142 (2%)
Frame = -3

Query: 431 PAFAGVSPSLRPSVT--TPTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNS 258
P+++ SPS P+ TPTS +Y S+ E T P P +S T
Sbjct: 16 PSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPT----- 70

Query: 257 SHGNPGMIHSAPSRNPTHE-YTDLARNYTPSYSQEYGLPMPVQPETAQNTLGPPPVYPPI 81
+P + P +PT Y+ + YTP+ S +Y P T+ P Y P
Sbjct: 71 ---SPTYSPTTPKYSPTSPTYSPTSPTYTPT-SPKYSPTSPTYSPTSPKYSPTSPTYSPT 126

Query: 80 RQQHDFSSDTARGYTPLQHGYT 15
+ S T+ GY+P Y+
Sbjct: 127 SPKGSTYSPTSPGYSPTSPTYS 148


>tr|A8PU11|A8PU11_BRUMA DNA-directed RNA polymerase OS=Brugia malayi
GN=Bm1_34315 PE=3 SV=1
Length = 1943

Score = 41.2 bits (95), Expect = 0.028
Identities = 41/160 (25%), Positives = 63/160 (39%), Gaps = 3/160 (1%)
Frame = -3

Query: 485 YGSSSEPFRFHNHGAVQFPAFAGVSPSLRPSVTT--PTSNAYLNSNSEADRTYGNNFPGR 312
YG+SS + V P ++ SPS P+ + PTS +Y ++ T + P
Sbjct: 1676 YGASSPAY------GVMSPRYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS 1729

Query: 311 PGQFSSSALGDKTGFHNSSHGNPGMIHSAPSRNPTH-EYTDLARNYTPSYSQEYGLPMPV 135
PG +S P ++PS +PT Y+ + Y+PS S Y P
Sbjct: 1730 PGYSPTS---------------PSYSPTSPSYSPTSPSYSPASPGYSPS-SPRYSPTSPA 1773

Query: 134 QPETAQNTLGPPPVYPPIRQQHDFSSDTARGYTPLQHGYT 15
T+ P Y P + S T+ Y+P GY+
Sbjct: 1774 YSPTSPTYSPTSPAYSPTSPTY---SPTSPSYSPASPGYS 1810



Score = 33.5 bits (75), Expect = 5.8
Identities = 32/138 (23%), Positives = 52/138 (37%)
Frame = -3

Query: 428 AFAGVSPSLRPSVTTPTSNAYLNSNSEADRTYGNNFPGRPGQFSSSALGDKTGFHNSSHG 249
+ G+SPS + + S+ + Y P P SS A G + ++ +
Sbjct: 1636 SLGGMSPSGAGAYSPAASDYGSGLEGLSSPGYSPTSPASPYGASSPAYGVMSPRYSPT-- 1693

Query: 248 NPGMIHSAPSRNPTHEYTDLARNYTPSYSQEYGLPMPVQPETAQNTLGPPPVYPPIRQQH 69
+P ++PS +PT +PSYS P P + + G P P
Sbjct: 1694 SPSYSPTSPSYSPT----------SPSYSPTSPSYSPTSPSYSPTSPGYSPTSPSYSPTS 1743

Query: 68 DFSSDTARGYTPLQHGYT 15
S T+ Y+P GY+
Sbjct: 1744 PSYSPTSPSYSPASPGYS 1761