BP915988
Clone id YMU001_000081_E05
Library
Length 390
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000081_E05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATATTTGAGCCAACTACTCATCTTCCGAAACAGCAAAGCTTTGTCCTGAATGTGTAGAAG
AGTATCACGACTGTAGATGACATCAAAAGACTCCGGAGAGTACTCTTTCTTAGTGCAATC
TGCTATCTCAAATTGCACTGCGCATTTGCGCCCAATCGCCCGCTCTAAAGCCAAGGATAT
CATATTTACAGAAAGGTCAATGCCCACAACATTGACATCGAATTCCTCGGCCATGTAGAA
ATCACCACCACCAATGCCACAACCGATATCCAGAACTCTCTGCCCGGGTTGAAGGTCCAA
CTTTTTCACAAACTCTGTTGTGGTCTCTTTTCCACCGGTGCTTACAAGACCTTCTCCAAA
AATCCACTCATATCGTAATATACCATTCAT
■■Homology search results ■■ -
sp_hit_id Q9C6B9
Definition sp|Q9C6B9|PEAM3_ARATH Putative phosphoethanolamine N-methyltransferase 3 OS=Arabidopsis thaliana
Align length 128
Score (bit) 206.0
E-value 3.0e-53
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915988|Adiantum capillus-veneris mRNA, clone:
YMU001_000081_E05.
(390 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9C6B9|PEAM3_ARATH Putative phosphoethanolamine N-methyltrans... 206 3e-53
sp|Q9M571|PEAMT_SPIOL Phosphoethanolamine N-methyltransferase OS... 205 5e-53
sp|Q944H0|PEAM2_ARATH Putative phosphoethanolamine N-methyltrans... 204 1e-52
sp|Q9FR44|PEAM1_ARATH Phosphoethanolamine N-methyltransferase 1 ... 201 7e-52
sp|P0A9H7|CFA_ECOLI Cyclopropane-fatty-acyl-phospholipid synthas... 59 1e-08
sp|P0A9H8|CFA_ECOL6 Cyclopropane-fatty-acyl-phospholipid synthas... 59 1e-08
sp|Q9ZSK1|GTOMC_ARATH Tocopherol O-methyltransferase, chloroplas... 57 2e-08
sp|Q9LM02|SMT1_ARATH Cycloartenol-C-24-methyltransferase OS=Arab... 52 1e-06
sp|Q6ZIX2|SMT1_ORYSJ Cycloartenol-C-24-methyltransferase 1 OS=Or... 51 2e-06
sp|P0C5C3|MMA1_MYCTU Methoxy mycolic acid synthase 1 OS=Mycobact... 50 5e-06
sp|A5U030|MMA1_MYCTA Methoxy mycolic acid synthase 1 OS=Mycobact... 50 5e-06
sp|P0A5Q1|MMA1_MYCBO Methoxy mycolic acid synthase 1 OS=Mycobact... 50 5e-06
sp|Q49807|CFA2_MYCLE Cyclopropane-fatty-acyl-phospholipid syntha... 50 5e-06
sp|P0C5C2|CFA1_MYCTU Cyclopropane-fatty-acyl-phospholipid syntha... 47 2e-05
sp|A5U866|CFA1_MYCTA Cyclopropane-fatty-acyl-phospholipid syntha... 47 2e-05
sp|O82427|SMT2_ORYSJ 24-methylenesterol C-methyltransferase 2 OS... 47 4e-05
sp|Q5EN22|ERG6_MAGGR Sterol 24-C-methyltransferase OS=Magnaporth... 47 4e-05
sp|P0A5P0|CFA2_MYCTU Cyclopropane-fatty-acyl-phospholipid syntha... 47 4e-05
sp|P0A5P1|CFA2_MYCBO Cyclopropane-fatty-acyl-phospholipid syntha... 47 4e-05
sp|Q2SE61|UBIG_HAHCH 3-demethylubiquinone-9 3-methyltransferase ... 46 5e-05
sp|Q6C2D9|ERG6_YARLI Sterol 24-C-methyltransferase OS=Yarrowia l... 46 5e-05
sp|Q875K1|ERG6_CLALS Sterol 24-C-methyltransferase OS=Clavispora... 46 5e-05
sp|Q8Y0Z5|UBIG_RALSO 3-demethylubiquinone-9 3-methyltransferase ... 46 7e-05
sp|Q39227|SMT2_ARATH 24-methylenesterol C-methyltransferase 2 OS... 46 7e-05
sp|O14321|ERG6_SCHPO Sterol 24-C-methyltransferase OS=Schizosacc... 46 7e-05
sp|Q9JXI7|UBIG_NEIMB 3-demethylubiquinone-9 3-methyltransferase ... 45 9e-05
sp|A9M0C4|UBIG_NEIM0 3-demethylubiquinone-9 3-methyltransferase ... 45 9e-05
sp|O74198|ERG6_CANAL Sterol 24-C-methyltransferase OS=Candida al... 45 9e-05
sp|Q9JWE6|UBIG_NEIMA 3-demethylubiquinone-9 3-methyltransferase ... 45 1e-04
sp|Q74LY0|UBIE_LACJO Menaquinone biosynthesis methyltransferase ... 45 1e-04

>sp|Q9C6B9|PEAM3_ARATH Putative phosphoethanolamine
N-methyltransferase 3 OS=Arabidopsis thaliana GN=NMT3
PE=2 SV=2
Length = 490

Score = 206 bits (524), Expect = 3e-53
Identities = 98/128 (76%), Positives = 110/128 (85%)
Frame = -1

Query: 387 NGILRYEWIFGEGLVSTGGKETTTEFVKKLDLQPGQRVLDIGCGIGGGDFYMAEEFDVNV 208
+GILRYE +FGEG VSTGG ETT EFV LDL+PGQ+VLD+GCGIGGGDFYMAE FDV+V
Sbjct: 248 SGILRYERVFGEGFVSTGGLETTKEFVDMLDLKPGQKVLDVGCGIGGGDFYMAENFDVDV 307

Query: 207 VGIDLSVNMISLALERAIGRKCAVQFEIADCTKKEYSPESFDVIYSRDTLLHIQDKALLF 28
VGIDLSVNMIS ALE AIG KC+V+FE+ADCTKKEY +FDVIYSRDT+LHIQDK LF
Sbjct: 308 VGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPALF 367

Query: 27 RKMSSWLK 4
R+ WLK
Sbjct: 368 RRFYKWLK 375


>sp|Q9M571|PEAMT_SPIOL Phosphoethanolamine N-methyltransferase
OS=Spinacia oleracea GN=PEAMT PE=1 SV=1
Length = 494

Score = 205 bits (522), Expect = 5e-53
Identities = 97/128 (75%), Positives = 108/128 (84%)
Frame = -1

Query: 387 NGILRYEWIFGEGLVSTGGKETTTEFVKKLDLQPGQRVLDIGCGIGGGDFYMAEEFDVNV 208
N ILRYE +FG G VSTGG ETT EFV KLDL+PGQ+VLD+GCGIGGGDFYMAE +DV V
Sbjct: 252 NSILRYERVFGPGYVSTGGLETTKEFVSKLDLKPGQKVLDVGCGIGGGDFYMAENYDVEV 311

Query: 207 VGIDLSVNMISLALERAIGRKCAVQFEIADCTKKEYSPESFDVIYSRDTLLHIQDKALLF 28
VGIDLS+NMIS ALER+IG KCAV+FE+ADCTKK+Y SFDVIYSRDT+LHIQDK LF
Sbjct: 312 VGIDLSINMISFALERSIGLKCAVEFEVADCTKKDYPENSFDVIYSRDTILHIQDKPALF 371

Query: 27 RKMSSWLK 4
R WLK
Sbjct: 372 RSFHKWLK 379


>sp|Q944H0|PEAM2_ARATH Putative phosphoethanolamine
N-methyltransferase 2 OS=Arabidopsis thaliana GN=NMT2
PE=2 SV=1
Length = 475

Score = 204 bits (519), Expect = 1e-52
Identities = 98/128 (76%), Positives = 109/128 (85%)
Frame = -1

Query: 387 NGILRYEWIFGEGLVSTGGKETTTEFVKKLDLQPGQRVLDIGCGIGGGDFYMAEEFDVNV 208
+GILRYE +FGEG VSTGG ETT EFV K+DL+PGQ+VLD+GCGIGGGDFYMAE FDV+V
Sbjct: 233 SGILRYERVFGEGYVSTGGFETTKEFVAKMDLKPGQKVLDVGCGIGGGDFYMAENFDVHV 292

Query: 207 VGIDLSVNMISLALERAIGRKCAVQFEIADCTKKEYSPESFDVIYSRDTLLHIQDKALLF 28
VGIDLSVNMIS ALERAIG KC+V+FE+ADCT K Y SFDVIYSRDT+LHIQDK LF
Sbjct: 293 VGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPALF 352

Query: 27 RKMSSWLK 4
R WLK
Sbjct: 353 RTFFKWLK 360


>sp|Q9FR44|PEAM1_ARATH Phosphoethanolamine N-methyltransferase 1
OS=Arabidopsis thaliana GN=NMT1 PE=2 SV=1
Length = 491

Score = 201 bits (512), Expect = 7e-52
Identities = 95/128 (74%), Positives = 110/128 (85%)
Frame = -1

Query: 387 NGILRYEWIFGEGLVSTGGKETTTEFVKKLDLQPGQRVLDIGCGIGGGDFYMAEEFDVNV 208
+GILRYE +FG+G VSTGG ETT EFV+K++L+PGQ+VLD+GCGIGGGDFYMAE+FDV+V
Sbjct: 249 SGILRYERVFGQGFVSTGGLETTKEFVEKMNLKPGQKVLDVGCGIGGGDFYMAEKFDVHV 308

Query: 207 VGIDLSVNMISLALERAIGRKCAVQFEIADCTKKEYSPESFDVIYSRDTLLHIQDKALLF 28
VGIDLSVNMIS ALERAIG C+V+FE+ADCT K Y SFDVIYSRDT+LHIQDK LF
Sbjct: 309 VGIDLSVNMISFALERAIGLSCSVEFEVADCTTKHYPDNSFDVIYSRDTILHIQDKPALF 368

Query: 27 RKMSSWLK 4
R WLK
Sbjct: 369 RTFFKWLK 376


>sp|P0A9H7|CFA_ECOLI Cyclopropane-fatty-acyl-phospholipid synthase
OS=Escherichia coli (strain K12) GN=cfa PE=1 SV=2
Length = 382

Score = 58.5 bits (140), Expect = 1e-08
Identities = 28/52 (53%), Positives = 35/52 (67%)
Frame = -1

Query: 306 KKLDLQPGQRVLDIGCGIGGGDFYMAEEFDVNVVGIDLSVNMISLALERAIG 151
+KL L+PG RVLDIGCG GG YMA +DV+VVG+ +S +A ER G
Sbjct: 161 EKLQLKPGMRVLDIGCGWGGLAHYMASNYDVSVVGVTISAEQQKMAQERCEG 212


>sp|P0A9H8|CFA_ECOL6 Cyclopropane-fatty-acyl-phospholipid synthase
OS=Escherichia coli O6 GN=cfa PE=3 SV=2
Length = 382

Score = 58.5 bits (140), Expect = 1e-08
Identities = 28/52 (53%), Positives = 35/52 (67%)
Frame = -1

Query: 306 KKLDLQPGQRVLDIGCGIGGGDFYMAEEFDVNVVGIDLSVNMISLALERAIG 151
+KL L+PG RVLDIGCG GG YMA +DV+VVG+ +S +A ER G
Sbjct: 161 EKLQLKPGMRVLDIGCGWGGLAHYMASNYDVSVVGVTISAEQQKMAQERCEG 212


>sp|Q9ZSK1|GTOMC_ARATH Tocopherol O-methyltransferase, chloroplastic
OS=Arabidopsis thaliana GN=G-TMT PE=2 SV=2
Length = 348

Score = 57.4 bits (137), Expect = 2e-08
Identities = 28/90 (31%), Positives = 50/90 (55%), Gaps = 2/90 (2%)
Frame = -1

Query: 282 QRVLDIGCGIGGGDFYMAEEFDVNVVGIDLSVNMISLALERAIGRKCA--VQFEIADCTK 109
++V+D+GCGIGG Y+A +F +GI LS A + A + A F++AD
Sbjct: 128 KKVVDVGCGIGGSSRYLASKFGAECIGITLSPVQAKRANDLAAAQSLAHKASFQVADALD 187

Query: 108 KEYSPESFDVIYSRDTLLHIQDKALLFRKM 19
+ + FD+++S ++ H+ DKA +++
Sbjct: 188 QPFEDGKFDLVWSMESGEHMPDKAKFVKEL 217


>sp|Q9LM02|SMT1_ARATH Cycloartenol-C-24-methyltransferase
OS=Arabidopsis thaliana GN=SMT1 PE=2 SV=1
Length = 336

Score = 51.6 bits (122), Expect = 1e-06
Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 2/102 (1%)
Frame = -1

Query: 303 KLDLQPGQRVLDIGCGIGGGDFYMAEEFDVNVVGIDLSVNMISLA--LERAIGRKCAVQF 130
+L +QPGQ+VLD+GCGIGG +A + V G++ + I+ L R G F
Sbjct: 89 QLGIQPGQKVLDVGCGIGGPLREIARFSNSVVTGLNNNEYQITRGKELNRLAGVDKTCNF 148

Query: 129 EIADCTKKEYSPESFDVIYSRDTLLHIQDKALLFRKMSSWLK 4
AD K + SFD +Y+ + H D ++++ LK
Sbjct: 149 VKADFMKMPFPENSFDAVYAIEATCHAPDAYGCYKEIYRVLK 190


>sp|Q6ZIX2|SMT1_ORYSJ Cycloartenol-C-24-methyltransferase 1 OS=Oryza
sativa subsp. japonica GN=Smt1-1 PE=2 SV=1
Length = 344

Score = 50.8 bits (120), Expect = 2e-06
Identities = 31/102 (30%), Positives = 52/102 (50%), Gaps = 2/102 (1%)
Frame = -1

Query: 303 KLDLQPGQRVLDIGCGIGGGDFYMAEEFDVNVVGIDLSVNMISLA--LERAIGRKCAVQF 130
+L ++PG +VLD+GCGIGG +A+ +V G++ + I+ L R G F
Sbjct: 95 QLGVKPGMKVLDVGCGIGGPLREIAKFSLASVTGLNNNEYQITRGKELNRVAGVSGTCDF 154

Query: 129 EIADCTKKEYSPESFDVIYSRDTLLHIQDKALLFRKMSSWLK 4
AD K +S +FD +Y+ + H D ++++ LK
Sbjct: 155 VKADFMKMPFSDNTFDAVYAIEATCHAPDPVGCYKEIYRVLK 196


>sp|P0C5C3|MMA1_MYCTU Methoxy mycolic acid synthase 1
OS=Mycobacterium tuberculosis GN=mma1 PE=3 SV=1
Length = 286

Score = 49.7 bits (117), Expect = 5e-06
Identities = 34/100 (34%), Positives = 49/100 (49%), Gaps = 24/100 (24%)
Frame = -1

Query: 303 KLDLQPGQRVLDIGCGIGGGDFYMAEEFDVNVVGIDLSVNMISLALER--AIGRK----- 145
KL+L+PG +LD+GCG GG E++DVNV+G+ LS N + +R AIG +
Sbjct: 58 KLNLEPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHYERSKDRLAAIGTQRRAEA 117

Query: 144 -------------CAVQFEIADCTKKE----YSPESFDVI 76
V FE D KKE + S+D++
Sbjct: 118 RLQGWEEFEENVDRIVSFEAFDAFKKERYLTFFERSYDIL 157


tr_hit_id A7PH63
Definition tr|A7PH63|A7PH63_VITVI Chromosome chr17 scaffold_16, whole genome shotgun sequence OS=Vitis vinifera
Align length 128
Score (bit) 206.0
E-value 4.0e-52
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915988|Adiantum capillus-veneris mRNA, clone:
YMU001_000081_E05.
(390 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PH63|A7PH63_VITVI Chromosome chr17 scaffold_16, whole genom... 206 4e-52
tr|Q0WUL3|Q0WUL3_ARATH Putative phosphoethanolamine N-methyltran... 206 5e-52
tr|A7P3Q0|A7P3Q0_VITVI Chromosome chr1 scaffold_5, whole genome ... 206 5e-52
tr|Q5NT83|Q5NT83_ATRNU Phosphoethanolamine N-methyltransferase O... 205 1e-51
tr|A5ANL8|A5ANL8_VITVI Putative uncharacterized protein OS=Vitis... 205 1e-51
tr|Q3ECU4|Q3ECU4_ARATH Uncharacterized protein At1g48600.2 OS=Ar... 204 2e-51
tr|Q6QA26|Q6QA26_ORYSA Phosphoethanolamine N-methyltransferase O... 204 2e-51
tr|Q4H1G5|Q4H1G5_BETVU Phosphoethanolamine N-methyltransferase O... 204 2e-51
tr|Q0JK57|Q0JK57_ORYSJ Os01g0695100 protein OS=Oryza sativa subs... 204 2e-51
tr|B8AWA2|B8AWA2_ORYSI Putative uncharacterized protein OS=Oryza... 203 4e-51
tr|B7FA34|B7FA34_ORYSJ cDNA, clone: J100040M09, full insert sequ... 203 4e-51
tr|A9NVZ7|A9NVZ7_PICSI Putative uncharacterized protein OS=Picea... 201 2e-50
tr|A7XZC6|A7XZC6_MAIZE S-adenosyl-L-methionine: phosphoethanolam... 201 2e-50
tr|Q8VYX1|Q8VYX1_WHEAT Phosphoethanolamine methyltransferase OS=... 200 3e-50
tr|Q7XJJ2|Q7XJJ2_BRANA Phosphoethanolamine N-methyltransferase O... 200 3e-50
tr|A9SAH0|A9SAH0_PHYPA Predicted protein OS=Physcomitrella paten... 199 4e-50
tr|A5X7D6|A5X7D6_SALEU Phosphoethanolamine N-methyltransferase O... 199 7e-50
tr|Q852S7|Q852S7_9CARY Phosphoethanolamine N-methyltransferase O... 198 1e-49
tr|A0N067|A0N067_9CARY Phosphoethanolamine N-methyltransferase O... 198 1e-49
tr|B6T8R8|B6T8R8_MAIZE Phosphoethanolamine N-methyltransferase O... 197 2e-49
tr|Q9AXH3|Q9AXH3_SOLLC Phosphoethanolamine N-methyltransferase O... 197 2e-49
tr|A2ZWU4|A2ZWU4_ORYSJ Putative uncharacterized protein OS=Oryza... 196 4e-49
tr|A2WU25|A2WU25_ORYSI Putative uncharacterized protein OS=Oryza... 196 4e-49
tr|Q84SA4|Q84SA4_ASTTR Phosphoethanolamine N-methyltransferase O... 192 7e-48
tr|A9XU50|A9XU50_GOSHI Phosphoethanolamine N-methyltransferase O... 192 9e-48
tr|Q5SDQ0|Q5SDQ0_MAIZE Putative phosphoethanolamine N-methyltran... 191 2e-47
tr|Q8L7A8|Q8L7A8_ARATH Phosphoethanolamine N-methyltransferase, ... 189 6e-47
tr|Q0DG78|Q0DG78_ORYSJ Os05g0548900 protein OS=Oryza sativa subs... 187 2e-46
tr|A4IHG2|A4IHG2_XENTR LOC100124841 protein OS=Xenopus tropicali... 174 3e-42
tr|B6LBC3|B6LBC3_BRAFL Putative uncharacterized protein OS=Branc... 173 4e-42

>tr|A7PH63|A7PH63_VITVI Chromosome chr17 scaffold_16, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00017822001
PE=4 SV=1
Length = 499

Score = 206 bits (525), Expect = 4e-52
Identities = 97/128 (75%), Positives = 109/128 (85%)
Frame = -1

Query: 387 NGILRYEWIFGEGLVSTGGKETTTEFVKKLDLQPGQRVLDIGCGIGGGDFYMAEEFDVNV 208
NGILRYE +FGEG VSTGG ETT EFV KLDL+PGQ+VLD+GCGIGGGDFYMAE FDV V
Sbjct: 257 NGILRYERVFGEGFVSTGGIETTKEFVGKLDLKPGQKVLDVGCGIGGGDFYMAENFDVEV 316

Query: 207 VGIDLSVNMISLALERAIGRKCAVQFEIADCTKKEYSPESFDVIYSRDTLLHIQDKALLF 28
VGIDLS+NM+S ALERAIG KC+V+FE+ADCTKK Y +FDVIYSRDT+LHIQDK LF
Sbjct: 317 VGIDLSINMVSFALERAIGLKCSVEFEVADCTKKSYPDNTFDVIYSRDTILHIQDKPALF 376

Query: 27 RKMSSWLK 4
+ WLK
Sbjct: 377 KSFFKWLK 384


>tr|Q0WUL3|Q0WUL3_ARATH Putative phosphoethanolamine
N-methyltransferase OS=Arabidopsis thaliana GN=At1g73600
PE=2 SV=1
Length = 504

Score = 206 bits (524), Expect = 5e-52
Identities = 98/128 (76%), Positives = 110/128 (85%)
Frame = -1

Query: 387 NGILRYEWIFGEGLVSTGGKETTTEFVKKLDLQPGQRVLDIGCGIGGGDFYMAEEFDVNV 208
+GILRYE +FGEG VSTGG ETT EFV LDL+PGQ+VLD+GCGIGGGDFYMAE FDV+V
Sbjct: 262 SGILRYERVFGEGFVSTGGLETTKEFVDMLDLKPGQKVLDVGCGIGGGDFYMAENFDVDV 321

Query: 207 VGIDLSVNMISLALERAIGRKCAVQFEIADCTKKEYSPESFDVIYSRDTLLHIQDKALLF 28
VGIDLSVNMIS ALE AIG KC+V+FE+ADCTKKEY +FDVIYSRDT+LHIQDK LF
Sbjct: 322 VGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPALF 381

Query: 27 RKMSSWLK 4
R+ WLK
Sbjct: 382 RRFYKWLK 389


>tr|A7P3Q0|A7P3Q0_VITVI Chromosome chr1 scaffold_5, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00030530001
PE=4 SV=1
Length = 481

Score = 206 bits (524), Expect = 5e-52
Identities = 97/127 (76%), Positives = 109/127 (85%)
Frame = -1

Query: 384 GILRYEWIFGEGLVSTGGKETTTEFVKKLDLQPGQRVLDIGCGIGGGDFYMAEEFDVNVV 205
GILRYE +FGEG VSTGG ETT EFV KLDL+P Q+VLD+GCGIGGGDFYMAE+FDV VV
Sbjct: 240 GILRYERVFGEGFVSTGGLETTKEFVTKLDLKPSQKVLDVGCGIGGGDFYMAEDFDVEVV 299

Query: 204 GIDLSVNMISLALERAIGRKCAVQFEIADCTKKEYSPESFDVIYSRDTLLHIQDKALLFR 25
GIDLS+NMIS+ALERAIGRKC V+FE+ADCTKK Y +FDVIYSRDT+LHIQDK LF+
Sbjct: 300 GIDLSINMISIALERAIGRKCLVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPALFK 359

Query: 24 KMSSWLK 4
WLK
Sbjct: 360 SFFKWLK 366


>tr|Q5NT83|Q5NT83_ATRNU Phosphoethanolamine N-methyltransferase
OS=Atriplex nummularia GN=AnPEAMT PE=2 SV=1
Length = 503

Score = 205 bits (521), Expect = 1e-51
Identities = 97/128 (75%), Positives = 108/128 (84%)
Frame = -1

Query: 387 NGILRYEWIFGEGLVSTGGKETTTEFVKKLDLQPGQRVLDIGCGIGGGDFYMAEEFDVNV 208
N ILRYE +FG G VSTGG ETT EFV KLDL+PGQ+VLD+GCGIGGGDFYMAE +DV V
Sbjct: 261 NSILRYERVFGPGYVSTGGVETTKEFVSKLDLKPGQKVLDVGCGIGGGDFYMAENYDVEV 320

Query: 207 VGIDLSVNMISLALERAIGRKCAVQFEIADCTKKEYSPESFDVIYSRDTLLHIQDKALLF 28
VGIDLS+NMIS ALER+IG KCAV+FE+ADCTKK+Y SFDVIYSRDT+LHIQDK LF
Sbjct: 321 VGIDLSINMISFALERSIGLKCAVEFEVADCTKKDYPENSFDVIYSRDTILHIQDKPALF 380

Query: 27 RKMSSWLK 4
R WLK
Sbjct: 381 RSFLKWLK 388


>tr|A5ANL8|A5ANL8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_041321 PE=4 SV=1
Length = 490

Score = 205 bits (521), Expect = 1e-51
Identities = 96/128 (75%), Positives = 109/128 (85%)
Frame = -1

Query: 387 NGILRYEWIFGEGLVSTGGKETTTEFVKKLDLQPGQRVLDIGCGIGGGDFYMAEEFDVNV 208
NGILRYE +FGEG VSTGG ETT EFV KLDL+PG++VLD+GCGIGGGDFYMAE FDV V
Sbjct: 248 NGILRYERVFGEGFVSTGGIETTKEFVGKLDLKPGRKVLDVGCGIGGGDFYMAENFDVEV 307

Query: 207 VGIDLSVNMISLALERAIGRKCAVQFEIADCTKKEYSPESFDVIYSRDTLLHIQDKALLF 28
VGIDLS+NM+S ALERAIG KC+V+FE+ADCTKK Y +FDVIYSRDT+LHIQDK LF
Sbjct: 308 VGIDLSINMVSFALERAIGLKCSVEFEVADCTKKSYPDNTFDVIYSRDTILHIQDKPALF 367

Query: 27 RKMSSWLK 4
+ WLK
Sbjct: 368 KSFFKWLK 375


>tr|Q3ECU4|Q3ECU4_ARATH Uncharacterized protein At1g48600.2
OS=Arabidopsis thaliana GN=At1g48600 PE=4 SV=1
Length = 491

Score = 204 bits (519), Expect = 2e-51
Identities = 98/128 (76%), Positives = 109/128 (85%)
Frame = -1

Query: 387 NGILRYEWIFGEGLVSTGGKETTTEFVKKLDLQPGQRVLDIGCGIGGGDFYMAEEFDVNV 208
+GILRYE +FGEG VSTGG ETT EFV K+DL+PGQ+VLD+GCGIGGGDFYMAE FDV+V
Sbjct: 249 SGILRYERVFGEGYVSTGGFETTKEFVAKMDLKPGQKVLDVGCGIGGGDFYMAENFDVHV 308

Query: 207 VGIDLSVNMISLALERAIGRKCAVQFEIADCTKKEYSPESFDVIYSRDTLLHIQDKALLF 28
VGIDLSVNMIS ALERAIG KC+V+FE+ADCT K Y SFDVIYSRDT+LHIQDK LF
Sbjct: 309 VGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPALF 368

Query: 27 RKMSSWLK 4
R WLK
Sbjct: 369 RTFFKWLK 376


>tr|Q6QA26|Q6QA26_ORYSA Phosphoethanolamine N-methyltransferase
OS=Oryza sativa GN=PEAMT PE=2 SV=1
Length = 499

Score = 204 bits (518), Expect = 2e-51
Identities = 95/128 (74%), Positives = 111/128 (86%)
Frame = -1

Query: 387 NGILRYEWIFGEGLVSTGGKETTTEFVKKLDLQPGQRVLDIGCGIGGGDFYMAEEFDVNV 208
+GILRYE IFGEG VSTGG ETT EFV +LDL+PGQ VLD+GCGIGGGDFYMA+++DV+V
Sbjct: 258 SGILRYERIFGEGFVSTGGIETTKEFVDRLDLKPGQNVLDVGCGIGGGDFYMADKYDVHV 317

Query: 207 VGIDLSVNMISLALERAIGRKCAVQFEIADCTKKEYSPESFDVIYSRDTLLHIQDKALLF 28
VGIDLS+NM+S ALERAIGRKC+V+FE+ADCTKK Y +FDVIYSRDT+LHIQDK LF
Sbjct: 318 VGIDLSINMVSFALERAIGRKCSVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPSLF 377

Query: 27 RKMSSWLK 4
+ WLK
Sbjct: 378 KSFFKWLK 385


>tr|Q4H1G5|Q4H1G5_BETVU Phosphoethanolamine N-methyltransferase
OS=Beta vulgaris GN=BvPEAMT1 PE=2 SV=1
Length = 494

Score = 204 bits (518), Expect = 2e-51
Identities = 98/128 (76%), Positives = 107/128 (83%)
Frame = -1

Query: 387 NGILRYEWIFGEGLVSTGGKETTTEFVKKLDLQPGQRVLDIGCGIGGGDFYMAEEFDVNV 208
N ILRYE +FG G VSTGG ETT EFV KLDL+PGQ+VLD GCGIGGGDFYMAE FDV V
Sbjct: 252 NSILRYERVFGPGYVSTGGFETTKEFVSKLDLKPGQKVLDAGCGIGGGDFYMAENFDVEV 311

Query: 207 VGIDLSVNMISLALERAIGRKCAVQFEIADCTKKEYSPESFDVIYSRDTLLHIQDKALLF 28
VGIDLS+NMIS ALER+IG KCAV+FE+ADCTKK Y +SFDVIYSRDT+LHIQDK LF
Sbjct: 312 VGIDLSINMISFALERSIGLKCAVEFEVADCTKKPYPEQSFDVIYSRDTILHIQDKPALF 371

Query: 27 RKMSSWLK 4
R WLK
Sbjct: 372 RNFYKWLK 379


>tr|Q0JK57|Q0JK57_ORYSJ Os01g0695100 protein OS=Oryza sativa subsp.
japonica GN=Os01g0695100 PE=4 SV=1
Length = 499

Score = 204 bits (518), Expect = 2e-51
Identities = 95/128 (74%), Positives = 111/128 (86%)
Frame = -1

Query: 387 NGILRYEWIFGEGLVSTGGKETTTEFVKKLDLQPGQRVLDIGCGIGGGDFYMAEEFDVNV 208
+GILRYE IFGEG VSTGG ETT EFV +LDL+PGQ VLD+GCGIGGGDFYMA+++DV+V
Sbjct: 258 SGILRYERIFGEGFVSTGGIETTKEFVDRLDLKPGQNVLDVGCGIGGGDFYMADKYDVHV 317

Query: 207 VGIDLSVNMISLALERAIGRKCAVQFEIADCTKKEYSPESFDVIYSRDTLLHIQDKALLF 28
VGIDLS+NM+S ALERAIGRKC+V+FE+ADCTKK Y +FDVIYSRDT+LHIQDK LF
Sbjct: 318 VGIDLSINMVSFALERAIGRKCSVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPSLF 377

Query: 27 RKMSSWLK 4
+ WLK
Sbjct: 378 KSFFKWLK 385


>tr|B8AWA2|B8AWA2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_20868 PE=4 SV=1
Length = 504

Score = 203 bits (516), Expect = 4e-51
Identities = 93/127 (73%), Positives = 109/127 (85%)
Frame = -1

Query: 384 GILRYEWIFGEGLVSTGGKETTTEFVKKLDLQPGQRVLDIGCGIGGGDFYMAEEFDVNVV 205
GILRYE +FGEG VSTGG ETT EFV KLDL+PGQ+VLD+GCGIGGGDFYMAE +D +V+
Sbjct: 264 GILRYERVFGEGYVSTGGIETTKEFVDKLDLKPGQKVLDVGCGIGGGDFYMAENYDAHVL 323

Query: 204 GIDLSVNMISLALERAIGRKCAVQFEIADCTKKEYSPESFDVIYSRDTLLHIQDKALLFR 25
GIDLS+NM+S A+ERAIGRKC+V+FE+ADCT K Y+P +FDVIYSRDT+LHI DK LFR
Sbjct: 324 GIDLSINMVSFAIERAIGRKCSVEFEVADCTTKTYAPNTFDVIYSRDTILHIHDKPALFR 383

Query: 24 KMSSWLK 4
WLK
Sbjct: 384 SFFKWLK 390