BP916033
Clone id YMU001_000082_C03
Library
Length 479
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000082_C03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GAACACAAAACAGACATGTGCTGGAGGCACAAACTGAGTGCAGGTCTGCGTACTTCACTG
CAAAGATGTTTTGCACGCATATTCATGAATACACTAATGAAACTTTTCAGCCTTTACTAA
TAAGGTTCTACCACAGCATGCTACAAATCTCACAAGGAGGAAATCTTTACTCACAGTATC
TCTTTATGTCCTTATATGTCTGAATGTTTGACGGTCACTGTAGATCCTGCAGTTTATTAC
TTCCCAGTAGGAAACAGCCTCAATATATGATGTGATGAAGAAGCAGACTTATTCTCTCTA
GTCCCAAGATTCTCCTTTGGATAACCCTGCGCAAATCTGTAAGGAGGAGGAGGTTTGCCA
TACGTATTACAAGCAAAAGGGTCCACTGGGGCAAAGGATCCCGTCACATTTGTCGCATCT
GCATGGCCCTGTCCCATAGGCATCGGTACATGTGGATTGGAGTAGGGTACATGCATCAT
■■Homology search results ■■ -
sp_hit_id Q5KE13
Definition sp|Q5KE13|BRO1_CRYNE Vacuolar protein-sorting protein BRO1 OS=Cryptococcus neoformans
Align length 69
Score (bit) 30.4
E-value 4.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916033|Adiantum capillus-veneris mRNA, clone:
YMU001_000082_C03.
(479 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5KE13|BRO1_CRYNE Vacuolar protein-sorting protein BRO1 OS=Cr... 30 4.3
sp|Q07008|NOTC1_RAT Neurogenic locus notch homolog protein 1 OS=... 30 7.4
sp|Q01705|NOTC1_MOUSE Neurogenic locus notch homolog protein 1 O... 30 7.4
sp|Q9D5R2|WDR20_MOUSE WD repeat-containing protein 20 OS=Mus mus... 29 9.6
sp|Q3U2P1|SC24A_MOUSE Protein transport protein Sec24A OS=Mus mu... 29 9.6
sp|P21783|NOTCH_XENLA Neurogenic locus notch protein homolog OS=... 29 9.6
sp|Q9DBT4|ENTP4_MOUSE Ectonucleoside triphosphate diphosphohydro... 29 9.6

>sp|Q5KE13|BRO1_CRYNE Vacuolar protein-sorting protein BRO1
OS=Cryptococcus neoformans GN=BRO1 PE=3 SV=1
Length = 957

Score = 30.4 bits (67), Expect = 4.3
Identities = 22/69 (31%), Positives = 31/69 (44%), Gaps = 3/69 (4%)
Frame = -1

Query: 461 SNPHVPMPMGQGHADATNVTGSFAPVDPFACNTYGKPPPPYRFAQGYPKENL---GTREN 291
S P++P P G+G ++NVT S+ P PPPP + Y L G+
Sbjct: 806 STPNLPPPPGRG---SSNVTSSYLP----------PPPPPKPQSNPYDFSTLAGFGSFAT 852

Query: 290 KSASSSHHI 264
S SS H+
Sbjct: 853 PSVSSPQHV 861


>sp|Q07008|NOTC1_RAT Neurogenic locus notch homolog protein 1
OS=Rattus norvegicus GN=Notch1 PE=1 SV=2
Length = 2531

Score = 29.6 bits (65), Expect = 7.4
Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 13/49 (26%)
Frame = -3

Query: 453 TCTDAYGTGPCRCDK-------------CDGILCPSGPFCL*YVWQTSS 346
TC D+YGT C C + CD C +G C WQT++
Sbjct: 1035 TCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGKC----WQTNT 1079


>sp|Q01705|NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus
musculus GN=Notch1 PE=1 SV=2
Length = 2531

Score = 29.6 bits (65), Expect = 7.4
Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 13/49 (26%)
Frame = -3

Query: 453 TCTDAYGTGPCRCDK-------------CDGILCPSGPFCL*YVWQTSS 346
TC D+YGT C C + CD C +G C WQT++
Sbjct: 1035 TCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGRC----WQTNT 1079


>sp|Q9D5R2|WDR20_MOUSE WD repeat-containing protein 20 OS=Mus
musculus GN=Wdr20 PE=1 SV=1
Length = 567

Score = 29.3 bits (64), Expect = 9.6
Identities = 17/59 (28%), Positives = 25/59 (42%), Gaps = 1/59 (1%)
Frame = -1

Query: 455 PHVPMPMGQGHADATNVTGSFAPVDPFACNTYGKP-PPPYRFAQGYPKENLGTRENKSA 282
PH P+ + HA+ N TG A + A T G PPP + P + +K +
Sbjct: 388 PHQPLSRARAHANVMNATGLPAGSNGSAVTTPGNSVPPPLPRSNSLPHSAVSNAASKGS 446


>sp|Q3U2P1|SC24A_MOUSE Protein transport protein Sec24A OS=Mus
musculus GN=Sec24a PE=1 SV=1
Length = 1090

Score = 29.3 bits (64), Expect = 9.6
Identities = 15/46 (32%), Positives = 19/46 (41%)
Frame = -1

Query: 455 PHVPMPMGQGHADATNVTGSFAPVDPFACNTYGKPPPPYRFAQGYP 318
P +P+P Q A +GSF P PPPP + YP
Sbjct: 106 PRMPLPTSQNPAATPMPSGSFLP--------GANPPPPLNWQYNYP 143


>sp|P21783|NOTCH_XENLA Neurogenic locus notch protein homolog
OS=Xenopus laevis GN=notch1 PE=1 SV=3
Length = 2524

Score = 29.3 bits (64), Expect = 9.6
Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 13/49 (26%)
Frame = -3

Query: 453 TCTDAYGTGPCRCDK-------------CDGILCPSGPFCL*YVWQTSS 346
TC D+YGT C C + CD C +G C WQT++
Sbjct: 1034 TCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKC----WQTNN 1078


>sp|Q9DBT4|ENTP4_MOUSE Ectonucleoside triphosphate
diphosphohydrolase 4 OS=Mus musculus GN=Entpd4 PE=2 SV=1
Length = 613

Score = 29.3 bits (64), Expect = 9.6
Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
Frame = -2

Query: 388 QWTLLLVIRMANLLLLTDLRRVIQRRILGLER-ISLLLHHIIY*GCFLL 245
QWTL ++ L L D+R+ + R R +S + +H ++ GCFL+
Sbjct: 525 QWTLGAILYRTRFLPLRDIRQEVFRAGHAHWRGVSFVYNHYLFSGCFLV 573


tr_hit_id B2VUY1
Definition tr|B2VUY1|B2VUY1_PYRTR E3 SUMO-protein ligase PIAS1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP)
Align length 50
Score (bit) 37.7
E-value 0.29
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916033|Adiantum capillus-veneris mRNA, clone:
YMU001_000082_C03.
(479 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B2VUY1|B2VUY1_PYRTR E3 SUMO-protein ligase PIAS1 OS=Pyrenopho... 38 0.29
tr|A1D201|A1D201_NEOFI Putative uncharacterized protein OS=Neosa... 37 0.37
tr|Q6MY74|Q6MY74_ASPFU Putative uncharacterized protein OS=Asper... 37 0.49
tr|B0XMP5|B0XMP5_ASPFC Putative uncharacterized protein OS=Asper... 37 0.49
tr|B7FY20|B7FY20_PHATR Predicted protein OS=Phaeodactylum tricor... 36 1.1
tr|Q2R8U1|Q2R8U1_ORYSJ Expressed protein OS=Oryza sativa subsp. ... 34 3.2
tr|A2ZCN8|A2ZCN8_ORYSI Putative uncharacterized protein OS=Oryza... 34 3.2
tr|B7QF81|B7QF81_IXOSC Sodium/chloride dependent transporter, pu... 33 5.4
tr|Q4SHQ6|Q4SHQ6_TETNG Chromosome 5 SCAF14581, whole genome shot... 33 9.2
tr|Q08XM6|Q08XM6_STIAU Putative uncharacterized protein OS=Stigm... 33 9.2
tr|A9V4Z5|A9V4Z5_MONBE Predicted protein OS=Monosiga brevicollis... 33 9.2
tr|B2W9S7|B2W9S7_PYRTR Putative uncharacterized protein OS=Pyren... 33 9.2

>tr|B2VUY1|B2VUY1_PYRTR E3 SUMO-protein ligase PIAS1 OS=Pyrenophora
tritici-repentis (strain Pt-1C-BFP) GN=PTRG_01118 PE=4
SV=1
Length = 582

Score = 37.7 bits (86), Expect = 0.29
Identities = 17/50 (34%), Positives = 24/50 (48%)
Frame = -1

Query: 467 PYSNPHVPMPMGQGHADATNVTGSFAPVDPFACNTYGKPPPPYRFAQGYP 318
PY+ P P+P G G A+ G+ P P+ + PPPP F + P
Sbjct: 94 PYTQPAPPIPNGYGMANGYQANGAARPYLPYGRDQPSVPPPPMTFFKDSP 143


>tr|A1D201|A1D201_NEOFI Putative uncharacterized protein
OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 /
NRRL 181) GN=NFIA_011270 PE=4 SV=1
Length = 117

Score = 37.4 bits (85), Expect = 0.37
Identities = 24/74 (32%), Positives = 30/74 (40%), Gaps = 9/74 (12%)
Frame = -1

Query: 467 PYSNPHVPMPMGQGHADATNVTG-----SFAPVDPFACNTYGKPPPP----YRFAQGYPK 315
PY +P P P G + D N G ++ P YG PPPP Y QGYP+
Sbjct: 22 PYGHPGSPPPPGGANQDYYNQGGYYPPQNYGPPPQQGYGGYGSPPPPGQPMYYPPQGYPQ 81

Query: 314 ENLGTRENKSASSS 273
+ G SS
Sbjct: 82 QQQGYYPEDRGGSS 95


>tr|Q6MY74|Q6MY74_ASPFU Putative uncharacterized protein
OS=Aspergillus fumigatus GN=AFUA_1G14150 PE=4 SV=1
Length = 117

Score = 37.0 bits (84), Expect = 0.49
Identities = 24/74 (32%), Positives = 29/74 (39%), Gaps = 9/74 (12%)
Frame = -1

Query: 467 PYSNPHVPMPMGQGHADATNVTG-----SFAPVDPFACNTYGKPPPP----YRFAQGYPK 315
PY +P P P G + D N G ++ P YG PPPP Y QGYP
Sbjct: 22 PYGHPGSPAPPGGANQDYYNQGGYYPPQNYGPPPQQGYGGYGSPPPPGQPMYYPPQGYPP 81

Query: 314 ENLGTRENKSASSS 273
+ G SS
Sbjct: 82 QQQGYYPEDRGGSS 95


>tr|B0XMP5|B0XMP5_ASPFC Putative uncharacterized protein
OS=Aspergillus fumigatus (strain CEA10 / CBS 144.89 /
FGSC A1163) GN=AFUB_013690 PE=4 SV=1
Length = 117

Score = 37.0 bits (84), Expect = 0.49
Identities = 24/74 (32%), Positives = 29/74 (39%), Gaps = 9/74 (12%)
Frame = -1

Query: 467 PYSNPHVPMPMGQGHADATNVTG-----SFAPVDPFACNTYGKPPPP----YRFAQGYPK 315
PY +P P P G + D N G ++ P YG PPPP Y QGYP
Sbjct: 22 PYGHPGSPAPPGGANQDYYNQGGYYPPQNYGPPPQQGYGGYGSPPPPGQPMYYPPQGYPP 81

Query: 314 ENLGTRENKSASSS 273
+ G SS
Sbjct: 82 QQQGYYPEDRGGSS 95


>tr|B7FY20|B7FY20_PHATR Predicted protein OS=Phaeodactylum
tricornutum CCAP 1055/1 GN=PHATRDRAFT_45546 PE=4 SV=1
Length = 719

Score = 35.8 bits (81), Expect = 1.1
Identities = 17/54 (31%), Positives = 22/54 (40%), Gaps = 4/54 (7%)
Frame = -1

Query: 458 NPHVPMPMGQ----GHADATNVTGSFAPVDPFACNTYGKPPPPYRFAQGYPKEN 309
NPH P P G G P +P+ + YG PPPP + G P +
Sbjct: 340 NPHGPPPSGSWSRHGPPPPQQSQAQPPPTNPYGTSNYGPPPPPQHLSHGPPSSS 393


>tr|Q2R8U1|Q2R8U1_ORYSJ Expressed protein OS=Oryza sativa subsp.
japonica GN=Os11g0216400 PE=4 SV=1
Length = 374

Score = 34.3 bits (77), Expect = 3.2
Identities = 15/36 (41%), Positives = 20/36 (55%)
Frame = -1

Query: 401 GSFAPVDPFACNTYGKPPPPYRFAQGYPKENLGTRE 294
G F P P A TYG+PP P +AQ +P G+ +
Sbjct: 291 GDFRPGGPSAPGTYGQPPAPGNYAQPHPPTYPGSNQ 326


>tr|A2ZCN8|A2ZCN8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_35548 PE=4 SV=1
Length = 392

Score = 34.3 bits (77), Expect = 3.2
Identities = 15/36 (41%), Positives = 20/36 (55%)
Frame = -1

Query: 401 GSFAPVDPFACNTYGKPPPPYRFAQGYPKENLGTRE 294
G F P P A TYG+PP P +AQ +P G+ +
Sbjct: 309 GDFRPGGPSAPGTYGQPPAPGNYAQPHPPTYPGSNQ 344


>tr|B7QF81|B7QF81_IXOSC Sodium/chloride dependent transporter,
putative (Fragment) OS=Ixodes scapularis
GN=IscW_ISCW022362 PE=4 SV=1
Length = 134

Score = 33.5 bits (75), Expect = 5.4
Identities = 17/43 (39%), Positives = 23/43 (53%)
Frame = +3

Query: 30 QTECRSAYFTAKMFCTHIHEYTNETFQPLLIRFYHSMLQISQG 158
+T CR+AY A CT+ + +E F FY +L ISQG
Sbjct: 57 ETSCRTAYINASYGCTNATQSASEQF------FYRHVLSISQG 93


>tr|Q4SHQ6|Q4SHQ6_TETNG Chromosome 5 SCAF14581, whole genome shotgun
sequence. (Fragment) OS=Tetraodon nigroviridis
GN=GSTENG00018047001 PE=4 SV=1
Length = 663

Score = 32.7 bits (73), Expect = 9.2
Identities = 19/65 (29%), Positives = 26/65 (40%), Gaps = 4/65 (6%)
Frame = -1

Query: 458 NPHVPMPMGQGHADATNVTGSFAPVDPFACNTYGKPPP----PYRFAQGYPKENLGTREN 291
+PHV +P H +P +PF Y PP P R YP++N EN
Sbjct: 339 HPHVNLPSPPRHRSDRESEPRRSPDEPFPPRWYSDDPPPSSQPSRPGPNYPRQNYREEEN 398

Query: 290 KSASS 276
+ S
Sbjct: 399 HARDS 403


>tr|Q08XM6|Q08XM6_STIAU Putative uncharacterized protein
OS=Stigmatella aurantiaca DW4/3-1 GN=STIAU_4031 PE=4
SV=1
Length = 461

Score = 32.7 bits (73), Expect = 9.2
Identities = 15/41 (36%), Positives = 20/41 (48%)
Frame = -1

Query: 434 GQGHADATNVTGSFAPVDPFACNTYGKPPPPYRFAQGYPKE 312
G+GH + AP P +C G PPPP R G P++
Sbjct: 298 GRGHRKGRHGRNLIAP-GPLSCRRCGSPPPPPRRVPGQPRQ 337