BP916037
Clone id YMU001_000082_C10
Library
Length 566
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000082_C10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTGGACGGACTAGACATGGGAAAGGCCGGGCTAGGTAGTGTGGAAAGGGAGTCCAACTAG
GGCAAAGGGCTAGGAGCCATGCTATATAGTGGGTGGTTGGGAGGTGTACTCCAAGTCTCT
AGTTCCCCTTGTCTAGCACATAATAGCATAGTAATGAAGATGGAGAATATGGCAACCTTA
AGCATTGAAGCATGGATCTTGGTTGGATTTGCACTCCATAGCAAGTAGAGGATCCATTTT
TACCATACGATAACTTTCCAAGATGGATGACTAATCCATTTGGTGCTTGGGAGACATAGC
TGCCGCAAGCATGTATGCTCTTGAGTCCATTTCATTCTCTCAAGTAGAGTGACAAATTCT
GCTTGGTGTTTGAGAGACGTCGTCATCACAAACATGATTCTAAGCATGCATACTATTTAA
ATTTGTGCACAATGAAAAGAGAACTAGTCTTATAAGATAGAAATATTGGTCATTTAAAAG
AAATTTGTACATTTTCTTACTCTAATGTAGCATTGTAAGCATTGACAAGGTTCATACTAT
CCTTAAGCTGTATTCCTTGCCTCCAA
■■Homology search results ■■ -
sp_hit_id P03690
Definition sp|P03690|VR2A_BPT4 Protein rIIA OS=Enterobacteria phage T4
Align length 49
Score (bit) 32.0
E-value 2.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916037|Adiantum capillus-veneris mRNA, clone:
YMU001_000082_C10.
(566 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P03690|VR2A_BPT4 Protein rIIA OS=Enterobacteria phage T4 GN=r... 32 2.2
sp|Q38RU7|COX2_SUNME Cytochrome c oxidase subunit 2 OS=Sundamys ... 26 8.5

>sp|P03690|VR2A_BPT4 Protein rIIA OS=Enterobacteria phage T4 GN=rIIA
PE=4 SV=2
Length = 725

Score = 32.0 bits (71), Expect = 2.2
Identities = 18/49 (36%), Positives = 26/49 (53%)
Frame = -3

Query: 501 SKKMYKFLLNDQYFYLIRLVLFSLCTNLNSMHA*NHVCDDDVSQTPSRI 355
S K++K L +D Y IR V+ L TN+ HA N + + Q P R+
Sbjct: 25 SPKVFKILSSDLYTNKIRAVVRELITNMIDAHALNGNPEKFIIQVPGRL 73


>sp|Q38RU7|COX2_SUNME Cytochrome c oxidase subunit 2 OS=Sundamys
muelleri GN=MT-CO2 PE=3 SV=1
Length = 227

Score = 26.2 bits (56), Expect(2) = 8.5
Identities = 14/39 (35%), Positives = 21/39 (53%)
Frame = -3

Query: 519 LTMLH*SKKMYKFLLNDQYFYLIRLVLFSLCTNLNSMHA 403
LT H M FL++ Y+I L+L + T+ N+M A
Sbjct: 20 LTNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTNTMDA 58



Score = 21.9 bits (45), Expect(2) = 8.5
Identities = 11/40 (27%), Positives = 18/40 (45%)
Frame = -1

Query: 404 LRIMFVMTTSLKHQAEFVTLLERMKWTQEHTCLRQLCLPS 285
LRI+++M T+ + W+ E+T LC S
Sbjct: 81 LRILYMMDEINNPALTVKTMGHQWYWSYEYTDYEDLCFDS 120


tr_hit_id A8THH9
Definition tr|A8THH9|A8THH9_METVO Ribosomal protein L34e OS=Methanococcus voltae A3
Align length 56
Score (bit) 34.7
E-value 3.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916037|Adiantum capillus-veneris mRNA, clone:
YMU001_000082_C10.
(566 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A8THH9|A8THH9_METVO Ribosomal protein L34e OS=Methanococcus v... 35 3.7
tr|Q6F9I2|Q6F9I2_ACIAD Short-chain fatty acid transporter (ScFAT... 33 8.3
tr|Q9V0C4|Q9V0C4_PYRAB HydD-1 cytochrome-c3 hydrogenase delta ch... 33 8.3

>tr|A8THH9|A8THH9_METVO Ribosomal protein L34e OS=Methanococcus
voltae A3 GN=MvolDRAFT_1591 PE=4 SV=1
Length = 88

Score = 34.7 bits (78), Expect = 3.7
Identities = 17/56 (30%), Positives = 28/56 (50%)
Frame = -2

Query: 367 TKQNLSLYLRE*NGLKSIHACGSYVSQAPNGLVIHLGKLSYGKNGSSTCYGVQIQP 200
TK N + Y R+ G+ ACG+ ++ PNG + L KL+ + +G + P
Sbjct: 19 TKGNTAHYRRKKQGVAKCGACGAVLNGVPNGRIAELSKLAKTEKRPERAFGGHLCP 74


>tr|Q6F9I2|Q6F9I2_ACIAD Short-chain fatty acid transporter (ScFAT
family) OS=Acinetobacter sp. (strain ADP1) GN=atoE PE=4
SV=1
Length = 469

Score = 33.5 bits (75), Expect = 8.3
Identities = 28/85 (32%), Positives = 38/85 (44%), Gaps = 1/85 (1%)
Frame = -2

Query: 298 YVSQAPNGLVIHLGKLSYGKNGSSTCYGVQIQPRSMLQCLR-LPYSPSSLLCYYVLDKGN 122
YV QA N L HLG N + + I P ML L L P ++ + V
Sbjct: 388 YVMQAANDLQYHLGWSVQIYNAAEALPNL-INPFFMLPMLGILKLKPKDVIGFTVT---- 442

Query: 121 *RLGVHLPTTHYIAWLLALCPSWTP 47
+L VHLP ++ W+L S+TP
Sbjct: 443 -QLVVHLPLVMFLLWILGKTLSYTP 466


>tr|Q9V0C4|Q9V0C4_PYRAB HydD-1 cytochrome-c3 hydrogenase delta chain
OS=Pyrococcus abyssi GN=PYRAB08660 PE=4 SV=1
Length = 261

Score = 33.5 bits (75), Expect = 8.3
Identities = 16/45 (35%), Positives = 28/45 (62%)
Frame = -2

Query: 262 LGKLSYGKNGSSTCYGVQIQPRSMLQCLRLPYSPSSLLCYYVLDK 128
+GKL G ++CYG Q+Q M + L+L + ++C+Y+LD+
Sbjct: 1 MGKLRIGFYALTSCYGCQLQLAMMDELLKL-IPNAEIVCWYMLDR 44