BP916102
Clone id YMU001_000083_B06
Library
Length 372
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000083_B06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTTCACTGACTCCGGCTCGTGTTCACTTGGTATCTGCTGCTTTCTTTTGATGATATCTAT
TATCTCCTCATGAAACTCACGTTTGGCAATCCCCAAGATATCACCCAATGTGAGCTCCAC
CTTGCTATTCATAATTTGCTCTTCAAAGACTTTCTTTAAATCTGTAGCTAATTCAATGTC
AGACTTGAGCTCATAAGAGGGTCCCCTGGGTTTACCTTGCTTTTTGTCCTTAGGTGCATC
CTCCATCACCACTTTAGGAGCGGGCTTAGGAGCAGGACTTTCTTCTTTCTTGTTGTTGAA
CCTCGTTGTCCTCTTCGATGTCCAGGAGCTTCTTCATCTCTTTTCCACTTTTCCTTCACC
ATAGCCTCATTA
■■Homology search results ■■ -
sp_hit_id Q567U6
Definition sp|Q567U6|CCD93_HUMAN Coiled-coil domain-containing protein 93 OS=Homo sapiens
Align length 94
Score (bit) 33.5
E-value 0.34
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916102|Adiantum capillus-veneris mRNA, clone:
YMU001_000083_B06.
(372 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q567U6|CCD93_HUMAN Coiled-coil domain-containing protein 93 O... 33 0.34
sp|P38771|RRF1_YEAST Ribosome-recycling factor, mitochondrial OS... 32 1.3
sp|A9BIX9|PUR9_PETMO Bifunctional purine biosynthesis protein pu... 31 2.2
sp|Q8CTX6|PFLB_STAES Formate acetyltransferase OS=Staphylococcus... 30 3.7
sp|Q5HKH9|PFLB_STAEQ Formate acetyltransferase OS=Staphylococcus... 30 3.7
sp|Q6F2B4|KSGA_MESFL Dimethyladenosine transferase OS=Mesoplasma... 30 3.7
sp|Q8FNZ7|HIS4_COREF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylam... 30 4.9
sp|Q5M775|SPEC1_HUMAN Sperm antigen with calponin homology and c... 29 6.3
sp|Q11077|YWV3_CAEEL Uncharacterized protein B0403.3 OS=Caenorha... 29 8.3
sp|Q0V1Z7|DRS1_PHANO ATP-dependent RNA helicase DRS1 OS=Phaeosph... 29 8.3
sp|P35220|CTNA_DROME Catenin alpha OS=Drosophila melanogaster GN... 29 8.3

>sp|Q567U6|CCD93_HUMAN Coiled-coil domain-containing protein 93
OS=Homo sapiens GN=CCDC93 PE=1 SV=2
Length = 631

Score = 33.5 bits (75), Expect = 0.34
Identities = 22/94 (23%), Positives = 44/94 (46%), Gaps = 13/94 (13%)
Frame = -1

Query: 246 MEDAPKDKKQGKPRGPSYELKSDIELATDLKKVFEEQIMNSKVELT-------------L 106
ME A +DKK P G S K+D +L+ E++I + ++T +
Sbjct: 217 MEKA-EDKKTALPAGLSATEKADAHEEDELRAAEEQRIQSLMTKMTAMANEESRLTASSV 275

Query: 105 GDILGIAKREFHEEIIDIIKRKQQIPSEHEPESV 4
G I+G+ E + + + +++ ++ +E PE +
Sbjct: 276 GQIVGLCSAEIKQIVSEYAEKQSELSAEESPEKL 309


>sp|P38771|RRF1_YEAST Ribosome-recycling factor, mitochondrial
OS=Saccharomyces cerevisiae GN=RRF1 PE=1 SV=1
Length = 230

Score = 31.6 bits (70), Expect = 1.3
Identities = 24/70 (34%), Positives = 35/70 (50%)
Frame = -1

Query: 243 EDAPKDKKQGKPRGPSYELKSDIELATDLKKVFEEQIMNSKVELTLGDILGIAKREFHEE 64
E P + Q K P +S +++A DLK+VFEE S ++ +LG I G +EF
Sbjct: 135 ERVPNNDLQLKVSLPPPTTESRLKVAKDLKRVFEE-YKQSSLKDSLGTIRGSILKEFKSF 193

Query: 63 IIDIIKRKQQ 34
D RK +
Sbjct: 194 KKDDAVRKAE 203


>sp|A9BIX9|PUR9_PETMO Bifunctional purine biosynthesis protein purH
OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=purH
PE=3 SV=1
Length = 508

Score = 30.8 bits (68), Expect = 2.2
Identities = 18/56 (32%), Positives = 28/56 (50%)
Frame = -1

Query: 198 SYELKSDIELATDLKKVFEEQIMNSKVELTLGDILGIAKREFHEEIIDIIKRKQQI 31
++ K D+E A +LKK+F E IM E+ EE +DI+K K+ +
Sbjct: 308 AFNRKIDVETALELKKIFLEIIM---------------APEYDEEALDILKEKKNL 348


>sp|Q8CTX6|PFLB_STAES Formate acetyltransferase OS=Staphylococcus
epidermidis (strain ATCC 12228) GN=pflB PE=3 SV=1
Length = 748

Score = 30.0 bits (66), Expect = 3.7
Identities = 17/31 (54%), Positives = 21/31 (67%), Gaps = 1/31 (3%)
Frame = -1

Query: 231 KDKKQGKPRGPSYE-LKSDIELATDLKKVFE 142
KD+K GK GPSYE +KSD+ D +VFE
Sbjct: 444 KDEKSGKQVGPSYEGIKSDV---LDYDEVFE 471


>sp|Q5HKH9|PFLB_STAEQ Formate acetyltransferase OS=Staphylococcus
epidermidis (strain ATCC 35984 / RP62A) GN=pflB PE=3
SV=1
Length = 748

Score = 30.0 bits (66), Expect = 3.7
Identities = 17/31 (54%), Positives = 21/31 (67%), Gaps = 1/31 (3%)
Frame = -1

Query: 231 KDKKQGKPRGPSYE-LKSDIELATDLKKVFE 142
KD+K GK GPSYE +KSD+ D +VFE
Sbjct: 444 KDEKSGKQVGPSYEGIKSDV---LDYDEVFE 471


>sp|Q6F2B4|KSGA_MESFL Dimethyladenosine transferase OS=Mesoplasma
florum GN=ksgA PE=3 SV=1
Length = 267

Score = 30.0 bits (66), Expect = 3.7
Identities = 22/83 (26%), Positives = 38/83 (45%)
Frame = -1

Query: 252 VVMEDAPKDKKQGKPRGPSYELKSDIELATDLKKVFEEQIMNSKVELTLGDILGIAKREF 73
+++E P K Y IE+ TD++ + +++I N EL L D+L +
Sbjct: 34 LIIEIGPGTGALTKLLAQKYNKVVAIEIDTDMEPILKKEITNDNFELFLSDVLLV----- 88

Query: 72 HEEIIDIIKRKQQIPSEHEPESV 4
+ +IK K+Q HE + V
Sbjct: 89 --DFEKLIKEKRQ----HENQKV 105


>sp|Q8FNZ7|HIS4_COREF
1-(5-phosphoribosyl)-5-[(5-
phosphoribosylamino)methylideneamino]
imidazole-4-carboxamide isomerase OS=Corynebacterium
efficiens GN=hisA PE=3 SV=1
Length = 246

Score = 29.6 bits (65), Expect = 4.9
Identities = 24/67 (35%), Positives = 33/67 (49%)
Frame = -1

Query: 249 VMEDAPKDKKQGKPRGPSYELKSDIELATDLKKVFEEQIMNSKVELTLGDILGIAKREFH 70
V+ D KD G GP+ +L D+ ATD V I TL D+LG+AK +
Sbjct: 167 VVTDVSKD---GTLTGPNVDLLRDVAAATDAPIVASGGIS------TLEDVLGLAK--YQ 215

Query: 69 EEIIDII 49
+E ID +
Sbjct: 216 DEGIDSV 222


>sp|Q5M775|SPEC1_HUMAN Sperm antigen with calponin homology and
coiled-coil domains 1 OS=Homo sapiens GN=SPECC1 PE=1
SV=1
Length = 1068

Score = 29.3 bits (64), Expect = 6.3
Identities = 18/56 (32%), Positives = 29/56 (51%)
Frame = -1

Query: 174 ELATDLKKVFEEQIMNSKVELTLGDILGIAKREFHEEIIDIIKRKQQIPSEHEPES 7
EL T +K+ EE+ N++++ LGD+ G H + + R P + EPES
Sbjct: 745 ELRTVKRKLLEEEEKNARLQKELGDVQG------HGRV--VTSRAAPPPVDEEPES 792


>sp|Q11077|YWV3_CAEEL Uncharacterized protein B0403.3
OS=Caenorhabditis elegans GN=B0403.3 PE=2 SV=2
Length = 270

Score = 28.9 bits (63), Expect = 8.3
Identities = 15/47 (31%), Positives = 22/47 (46%)
Frame = +1

Query: 217 LLFVLRCILHHHFRSGLRSRTFFFLVVEPRCPLRCPGASSSLFHFSF 357
+LF + CI + H G R + + P C + C G S FH +F
Sbjct: 8 ILFAVVCISYCHKSRGRRHFGDEYRINTPACDIVCEGQWKSEFHANF 54


>sp|Q0V1Z7|DRS1_PHANO ATP-dependent RNA helicase DRS1
OS=Phaeosphaeria nodorum GN=DRS1 PE=3 SV=1
Length = 808

Score = 28.9 bits (63), Expect = 8.3
Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 5/52 (9%)
Frame = -1

Query: 237 APKDKKQGKPRG-----PSYELKSDIELATDLKKVFEEQIMNSKVELTLGDI 97
A KDKK+GK P+ E +SD+E+A + V ++S+ E +GDI
Sbjct: 62 AKKDKKKGKKGKQAEPEPAAEDESDLEIAHPGEDVEGNDDIDSEFEFAVGDI 113


tr_hit_id A9SUM8
Definition tr|A9SUM8|A9SUM8_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 66
Score (bit) 88.6
E-value 1.0e-16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916102|Adiantum capillus-veneris mRNA, clone:
YMU001_000083_B06.
(372 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9SUM8|A9SUM8_PHYPA Predicted protein OS=Physcomitrella paten... 89 1e-16
tr|A9T9C2|A9T9C2_PHYPA Predicted protein OS=Physcomitrella paten... 88 2e-16
tr|A9SBL6|A9SBL6_PHYPA Predicted protein OS=Physcomitrella paten... 88 2e-16
tr|A9TMV1|A9TMV1_PHYPA Predicted protein OS=Physcomitrella paten... 87 3e-16
tr|A9RT73|A9RT73_PHYPA Predicted protein OS=Physcomitrella paten... 87 3e-16
tr|A9RJ89|A9RJ89_PHYPA Predicted protein OS=Physcomitrella paten... 87 4e-16
tr|A9RCA2|A9RCA2_PHYPA Predicted protein OS=Physcomitrella paten... 87 4e-16
tr|A9TWG5|A9TWG5_PHYPA Predicted protein OS=Physcomitrella paten... 87 5e-16
tr|A9SRH0|A9SRH0_PHYPA Predicted protein OS=Physcomitrella paten... 87 5e-16
tr|A9RCF3|A9RCF3_PHYPA Predicted protein OS=Physcomitrella paten... 87 5e-16
tr|A9S8W5|A9S8W5_PHYPA Predicted protein OS=Physcomitrella paten... 86 7e-16
tr|A9TZK3|A9TZK3_PHYPA Predicted protein OS=Physcomitrella paten... 86 9e-16
tr|A9SMK9|A9SMK9_PHYPA Predicted protein OS=Physcomitrella paten... 86 1e-15
tr|A9S1T3|A9S1T3_PHYPA Predicted protein OS=Physcomitrella paten... 86 1e-15
tr|A9SU30|A9SU30_PHYPA Predicted protein OS=Physcomitrella paten... 85 2e-15
tr|A9RID4|A9RID4_PHYPA Predicted protein OS=Physcomitrella paten... 85 2e-15
tr|A9RQL4|A9RQL4_PHYPA Predicted protein OS=Physcomitrella paten... 85 2e-15
tr|A9RAT5|A9RAT5_PHYPA Predicted protein OS=Physcomitrella paten... 85 2e-15
tr|A9TS33|A9TS33_PHYPA Predicted protein OS=Physcomitrella paten... 84 3e-15
tr|A9TKA1|A9TKA1_PHYPA Predicted protein OS=Physcomitrella paten... 84 3e-15
tr|A9TLS3|A9TLS3_PHYPA Predicted protein OS=Physcomitrella paten... 83 6e-15
tr|A9S3G8|A9S3G8_PHYPA Predicted protein OS=Physcomitrella paten... 83 6e-15
tr|A9TY42|A9TY42_PHYPA Predicted protein OS=Physcomitrella paten... 83 8e-15
tr|A9TQ49|A9TQ49_PHYPA Predicted protein OS=Physcomitrella paten... 83 8e-15
tr|A9TLY3|A9TLY3_PHYPA Predicted protein OS=Physcomitrella paten... 83 8e-15
tr|A9RIU3|A9RIU3_PHYPA Predicted protein OS=Physcomitrella paten... 83 8e-15
tr|A9SAB5|A9SAB5_PHYPA Predicted protein OS=Physcomitrella paten... 82 1e-14
tr|A9RR85|A9RR85_PHYPA Predicted protein OS=Physcomitrella paten... 82 1e-14
tr|A9TEM5|A9TEM5_PHYPA Predicted protein OS=Physcomitrella paten... 82 2e-14
tr|A9SP90|A9SP90_PHYPA Predicted protein OS=Physcomitrella paten... 82 2e-14

>tr|A9SUM8|A9SUM8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_84202 PE=4 SV=1
Length = 238

Score = 88.6 bits (218), Expect = 1e-16
Identities = 42/66 (63%), Positives = 55/66 (83%)
Frame = -1

Query: 231 KDKKQGKPRGPSYELKSDIELATDLKKVFEEQIMNSKVELTLGDILGIAKREFHEEIIDI 52
++ ++ K + P+Y+L+SDIE ATDLKKV EEQI++ KVE T+G+ILGIAK EFHE IID
Sbjct: 9 REIRKEKAKAPAYKLQSDIEAATDLKKVLEEQILSGKVEFTIGEILGIAKHEFHEVIIDT 68

Query: 51 IKRKQQ 34
IKRK+Q
Sbjct: 69 IKRKRQ 74


>tr|A9T9C2|A9T9C2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_89784 PE=4 SV=1
Length = 750

Score = 88.2 bits (217), Expect = 2e-16
Identities = 42/69 (60%), Positives = 56/69 (81%)
Frame = -1

Query: 228 DKKQGKPRGPSYELKSDIELATDLKKVFEEQIMNSKVELTLGDILGIAKREFHEEIIDII 49
D+ +GK + +Y+L+SDIE ATDLK V EE+++N+K+E TL +ILGIAKREFHE IID I
Sbjct: 470 DRDKGKSKHVTYKLQSDIEAATDLKGVLEERVLNAKIEFTLREILGIAKREFHEVIIDTI 529

Query: 48 KRKQQIPSE 22
KRK+Q+ E
Sbjct: 530 KRKKQLAGE 538


>tr|A9SBL6|A9SBL6_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_77158 PE=4 SV=1
Length = 718

Score = 88.2 bits (217), Expect = 2e-16
Identities = 42/69 (60%), Positives = 56/69 (81%)
Frame = -1

Query: 228 DKKQGKPRGPSYELKSDIELATDLKKVFEEQIMNSKVELTLGDILGIAKREFHEEIIDII 49
D+ +GK + +Y+L+SDIE ATDLK V EE+++N+K+E TL +ILGIAKREFHE IID I
Sbjct: 438 DRDKGKSKHVTYKLQSDIEAATDLKGVLEERVLNAKIEFTLREILGIAKREFHEVIIDTI 497

Query: 48 KRKQQIPSE 22
KRK+Q+ E
Sbjct: 498 KRKRQLTGE 506


>tr|A9TMV1|A9TMV1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_94810 PE=4 SV=1
Length = 284

Score = 87.4 bits (215), Expect = 3e-16
Identities = 40/66 (60%), Positives = 56/66 (84%)
Frame = -1

Query: 228 DKKQGKPRGPSYELKSDIELATDLKKVFEEQIMNSKVELTLGDILGIAKREFHEEIIDII 49
DK +GK + +Y+L+SDIE ATDLK++ +E+++N+K+E TL +ILGIAKREFHE IID I
Sbjct: 4 DKDKGKSKHVTYKLQSDIEAATDLKRILKERVLNAKIEFTLREILGIAKREFHEVIIDTI 63

Query: 48 KRKQQI 31
KRK+Q+
Sbjct: 64 KRKRQL 69


>tr|A9RT73|A9RT73_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_70237 PE=4 SV=1
Length = 511

Score = 87.4 bits (215), Expect = 3e-16
Identities = 42/69 (60%), Positives = 55/69 (79%)
Frame = -1

Query: 228 DKKQGKPRGPSYELKSDIELATDLKKVFEEQIMNSKVELTLGDILGIAKREFHEEIIDII 49
DK +GK + +Y+L+SDIE ATDLK V EE+++N+K+E TL +ILGI KREFHE IID I
Sbjct: 267 DKDKGKNKHVTYKLQSDIEAATDLKGVLEERVLNAKIEFTLQEILGITKREFHEVIIDTI 326

Query: 48 KRKQQIPSE 22
KRK+Q+ E
Sbjct: 327 KRKRQLTGE 335


>tr|A9RJ89|A9RJ89_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_66857 PE=4 SV=1
Length = 631

Score = 87.0 bits (214), Expect = 4e-16
Identities = 42/69 (60%), Positives = 56/69 (81%)
Frame = -1

Query: 228 DKKQGKPRGPSYELKSDIELATDLKKVFEEQIMNSKVELTLGDILGIAKREFHEEIIDII 49
DK +GK + +Y+L+SDIE AT+LK V EE+++N+K+E TL +ILGIAKREFHE IID I
Sbjct: 396 DKDKGKNKHVTYKLQSDIEAATNLKGVLEERVLNAKIEFTLREILGIAKREFHEVIIDTI 455

Query: 48 KRKQQIPSE 22
KRK+Q+ E
Sbjct: 456 KRKRQLTGE 464


>tr|A9RCA2|A9RCA2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_64451 PE=4 SV=1
Length = 363

Score = 87.0 bits (214), Expect = 4e-16
Identities = 41/69 (59%), Positives = 56/69 (81%)
Frame = -1

Query: 228 DKKQGKPRGPSYELKSDIELATDLKKVFEEQIMNSKVELTLGDILGIAKREFHEEIIDII 49
D+ +GK + +Y+L+SDIE ATDLK V E++++N+K+E TL +ILGIAKREFHE IID I
Sbjct: 246 DRNKGKSKHVTYKLQSDIEAATDLKGVLEKRVLNAKIEFTLREILGIAKREFHEVIIDTI 305

Query: 48 KRKQQIPSE 22
KRK+Q+ E
Sbjct: 306 KRKRQLTGE 314


>tr|A9TWG5|A9TWG5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_98198 PE=4 SV=1
Length = 645

Score = 86.7 bits (213), Expect = 5e-16
Identities = 41/69 (59%), Positives = 56/69 (81%)
Frame = -1

Query: 228 DKKQGKPRGPSYELKSDIELATDLKKVFEEQIMNSKVELTLGDILGIAKREFHEEIIDII 49
D+ +GK + +Y+L+SDIE ATDLK V EE+++N+K+E TL +ILGIAKREFHE IID I
Sbjct: 385 DRDKGKSKHVTYKLQSDIEAATDLKGVLEERVLNAKIEFTLREILGIAKREFHEVIIDTI 444

Query: 48 KRKQQIPSE 22
K+K+Q+ E
Sbjct: 445 KQKRQLTGE 453


>tr|A9SRH0|A9SRH0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_82868 PE=4 SV=1
Length = 435

Score = 86.7 bits (213), Expect = 5e-16
Identities = 42/69 (60%), Positives = 55/69 (79%)
Frame = -1

Query: 228 DKKQGKPRGPSYELKSDIELATDLKKVFEEQIMNSKVELTLGDILGIAKREFHEEIIDII 49
DK +GK + +Y+L+ DIE ATDLK V EE+++N+K+E TL +ILGIAKREFHE IID I
Sbjct: 63 DKDKGKSKHVTYKLQYDIEAATDLKGVLEERVLNAKIEFTLREILGIAKREFHEVIIDTI 122

Query: 48 KRKQQIPSE 22
KRK+Q+ E
Sbjct: 123 KRKRQLARE 131


>tr|A9RCF3|A9RCF3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_64503 PE=4 SV=1
Length = 643

Score = 86.7 bits (213), Expect = 5e-16
Identities = 41/69 (59%), Positives = 56/69 (81%)
Frame = -1

Query: 228 DKKQGKPRGPSYELKSDIELATDLKKVFEEQIMNSKVELTLGDILGIAKREFHEEIIDII 49
D+ +GK + +Y+L+SDIE ATDLK V EE+++N+K+E TL +ILGIAKREFHE IID I
Sbjct: 399 DRDKGKSKHVTYKLQSDIEAATDLKGVLEERVLNAKIEFTLREILGIAKREFHEVIIDTI 458

Query: 48 KRKQQIPSE 22
KRK+++ E
Sbjct: 459 KRKRKLTGE 467