BP916114
Clone id YMU001_000083_C10
Library
Length 470
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000083_C10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GACCAATTGGAGGTGTCCCTTCCATACAATGCCGTCTTCTGCTGCTCTCCCTCCAAGAAA
GAGCTGCAGTCTATGAAGAAGCTGTGGCCTCGCTTCAAAAAAGTAGCCTTCATCATCCAA
ACGCTGAAAAATTGTACGAGAGAGCGTCTCGCCACGAGGAACAATTGATACACGCTCGCA
GTATTCCAGTTTGGCTCCTTCCAAGCGACGAAGTATGTGGGTAGTCATCGCCAGCCCAAC
TTCAAGGGTTGCCATTCGTCGATGCACAGGAAGCCCACGGTCGACTCCGAATCGTTGTGG
GCCAACAGTGATCCGATCGACTGCAAGGTCCAAGTCCTTCTGAACAATGTGAGGATGCCC
GTTCCTTACAGCCATCATCGCACCTTCTTGTAAGAGCTGTGCCAACTCTGCACCTGTCCA
CCCTGGCAGATTCTTGGCGACAACCCAGAGATCAACTTCTGGGGCAAGCT
■■Homology search results ■■ -
sp_hit_id O67077
Definition sp|O67077|FTSH_AQUAE Cell division protease ftsH homolog OS=Aquifex aeolicus
Align length 145
Score (bit) 82.8
E-value 7.0e-16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916114|Adiantum capillus-veneris mRNA, clone:
YMU001_000083_C10.
(470 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O67077|FTSH_AQUAE Cell division protease ftsH homolog OS=Aqui... 83 7e-16
sp|Q9TJ83|FTSH_CYAME Cell division protease ftsH homolog OS=Cyan... 74 3e-13
sp|O83746|FTSH_TREPA Cell division protease ftsH homolog OS=Trep... 72 9e-13
sp|Q55700|FTSH1_SYNY3 Cell division protease ftsH homolog 1 OS=S... 71 2e-12
sp|Q1XDF9|FSTH_PORYE Cell division protease ftsH homolog OS=Porp... 71 2e-12
sp|O78516|FTSH_GUITH Cell division protease ftsH homolog OS=Guil... 69 8e-12
sp|O80983|FTSH4_ARATH Cell division protease ftsH homolog 4, mit... 69 8e-12
sp|P51327|FTSH_PORPU Cell division protease ftsH homolog OS=Porp... 68 2e-11
sp|Q655S1|FTSH2_ORYSJ Cell division protease ftsH homolog 2, chl... 68 2e-11
sp|P37476|FTSH_BACSU Cell division protease ftsH homolog OS=Baci... 67 3e-11
sp|Q8LQJ8|FTSH5_ORYSJ Cell division protease ftsH homolog 5, mit... 67 3e-11
sp|P94304|FTSH_BACPF Cell division protease ftsH homolog OS=Baci... 66 7e-11
sp|Q5Z974|FTSH1_ORYSJ Cell division protease ftsH homolog 1, chl... 66 7e-11
sp|Q67WJ2|FTSH6_ORYSJ Cell division protease ftsH homolog 6, chl... 65 1e-10
sp|Q8LQJ9|FTSH4_ORYSJ Cell division protease ftsH homolog 4, mit... 65 1e-10
sp|Q89AF2|FTSH_BUCBP Cell division protease ftsH OS=Buchnera aph... 65 2e-10
sp|Q8W585|FTSH8_ARATH Cell division protease ftsH homolog 8, chl... 65 2e-10
sp|Q1PDW5|FTSH6_ARATH Cell division protease ftsH homolog 6, chl... 64 3e-10
sp|P72991|FTSH4_SYNY3 Cell division protease ftsH homolog 4 OS=S... 64 3e-10
sp|Q39444|FTSH_CAPAN Cell division protease ftsH homolog, chloro... 64 3e-10
sp|Q39102|FTSH1_ARATH Cell division protease ftsH homolog 1, chl... 64 3e-10
sp|P0AAI4|FTSH_SHIFL Cell division protease ftsH OS=Shigella fle... 64 4e-10
sp|P49825|FTSH_ODOSI Cell division protease ftsH homolog OS=Odon... 64 4e-10
sp|P0AAI3|FTSH_ECOLI Cell division protease ftsH OS=Escherichia ... 64 4e-10
sp|Q8X9L0|FTSH_ECO57 Cell division protease ftsH OS=Escherichia ... 64 4e-10
sp|O19922|FTSH_CYACA Cell division protease ftsH homolog OS=Cyan... 64 4e-10
sp|O80860|FTSH2_ARATH Cell division protease ftsH homolog 2, chl... 64 4e-10
sp|Q9FH02|FTSH5_ARATH Cell division protease ftsH homolog 5, chl... 63 6e-10
sp|O88967|YMEL1_MOUSE ATP-dependent metalloprotease YME1L1 OS=Mu... 63 7e-10
sp|Q96TA2|YMEL1_HUMAN ATP-dependent metalloprotease YME1L1 OS=Ho... 63 7e-10

>sp|O67077|FTSH_AQUAE Cell division protease ftsH homolog OS=Aquifex
aeolicus GN=ftsH PE=1 SV=1
Length = 634

Score = 82.8 bits (203), Expect = 7e-16
Identities = 53/145 (36%), Positives = 80/145 (55%)
Frame = -3

Query: 468 LAPEVDLWVVAKNLPGWTGAELAQLLQEGAMMAVRNGHPHIVQKDLDLAVDRITVGPQRF 289
LA +VDL VA+ PG+TGA+L LL E A++A R G I ++++ A+DRIT+G +R
Sbjct: 344 LAKDVDLEFVARATPGFTGADLENLLNEAALLAARKGKEEITMEEIEEALDRITMGLERK 403

Query: 288 GVDRGLPVHRRMATLEVGLAMTTHILRRLEGAKLEYCERVSIVPRGETLSRTIFQRLDDE 109
G+ ++A E G H L L + ++SI+PRG L T Q+L E
Sbjct: 404 GMTISPKEKEKIAIHEAG-----HALMGLVSDDDDKVHKISIIPRGMALGVT--QQLPIE 456

Query: 108 GYFFEARPQLLHRLQLFLGGRAAED 34
+ L +++ + LGGRAAE+
Sbjct: 457 DKHIYDKKDLYNKILVLLGGRAAEE 481


>sp|Q9TJ83|FTSH_CYAME Cell division protease ftsH homolog
OS=Cyanidioschyzon merolae GN=ftsH PE=3 SV=1
Length = 603

Score = 73.9 bits (180), Expect = 3e-13
Identities = 49/147 (33%), Positives = 79/147 (53%)
Frame = -3

Query: 468 LAPEVDLWVVAKNLPGWTGAELAQLLQEGAMMAVRNGHPHIVQKDLDLAVDRITVGPQRF 289
L P+V L VA+ G+ GA+LA LL E A++AVR G I K++D A+DR+ G +
Sbjct: 342 LHPQVSLEAVARRTAGFAGADLANLLNEAAILAVRRGLKQITWKEIDDAIDRVIAGMEGT 401

Query: 288 GVDRGLPVHRRMATLEVGLAMTTHILRRLEGAKLEYCERVSIVPRGETLSRTIFQRLDDE 109
+ G + R +A E G A+T +L ++V+++PR + T F + D
Sbjct: 402 PIMDG-KIKRLIAYHETGHALTATLLPNHPPV-----QKVTLIPRRQAKGLTWF--MQDN 453

Query: 108 GYFFEARPQLLHRLQLFLGGRAAEDGI 28
++ QL+ + + LGGRAAE+ +
Sbjct: 454 ERDLLSKSQLMSMIMVALGGRAAEEAV 480


>sp|O83746|FTSH_TREPA Cell division protease ftsH homolog
OS=Treponema pallidum GN=ftsH PE=3 SV=1
Length = 609

Score = 72.4 bits (176), Expect = 9e-13
Identities = 49/144 (34%), Positives = 79/144 (54%)
Frame = -3

Query: 468 LAPEVDLWVVAKNLPGWTGAELAQLLQEGAMMAVRNGHPHIVQKDLDLAVDRITVGPQRF 289
LAPEVDL VA+ G++GA+LA ++ E A++AVR+G +++ DLD AV++ +G Q+
Sbjct: 328 LAPEVDLKAVARITGGYSGADLANVVNEAALLAVRSGRAQVIETDLDEAVEKTMIGLQKK 387

Query: 288 GVDRGLPVHRRMATLEVGLAMTTHILRRLEGAKLEYCERVSIVPRGETLSRTIFQRLDDE 109
R +A E G A+ + GA + +++I+PRG + F +D+
Sbjct: 388 SRVIREEERRIIAYHETGHALAGTFTK---GA--DKVHKITIIPRGTSALGYTFHIPEDD 442

Query: 108 GYFFEARPQLLHRLQLFLGGRAAE 37
+ QLL + + L GRAAE
Sbjct: 443 RHIV-TEQQLLAEVDVLLSGRAAE 465


>sp|Q55700|FTSH1_SYNY3 Cell division protease ftsH homolog 1
OS=Synechocystis sp. (strain PCC 6803) GN=slr0228 PE=3
SV=1
Length = 627

Score = 71.2 bits (173), Expect = 2e-12
Identities = 49/152 (32%), Positives = 82/152 (53%), Gaps = 5/152 (3%)
Frame = -3

Query: 468 LAPEVDLWVVAKNLPGWTGAELAQLLQEGAMMAVRNGHPHIVQKDLDLAVDRITVGPQRF 289
LAPEV + +A+ PG++GA+LA LL E A++ R I ++D AVDR+ G +
Sbjct: 360 LAPEVSIDSIARRTPGFSGADLANLLNEAAILTARRRKSAITLLEIDDAVDRVVAGME-- 417

Query: 288 GVDRGLPV-----HRRMATLEVGLAMTTHILRRLEGAKLEYCERVSIVPRGETLSRTIFQ 124
G P+ R +A EVG A+ +L+ + ++V+++PRG+ T F
Sbjct: 418 ----GTPLVDSKSKRLIAYHEVGHAIVGTLLKDHDPV-----QKVTLIPRGQAQGLTWFT 468

Query: 123 RLDDEGYFFEARPQLLHRLQLFLGGRAAEDGI 28
+++G + QL+ R+ +GGRAAE+ +
Sbjct: 469 PNEEQG--LTTKAQLMARIAGAMGGRAAEEEV 498


>sp|Q1XDF9|FSTH_PORYE Cell division protease ftsH homolog
OS=Porphyra yezoensis GN=ftsH PE=3 SV=1
Length = 628

Score = 71.2 bits (173), Expect = 2e-12
Identities = 47/150 (31%), Positives = 79/150 (52%), Gaps = 5/150 (3%)
Frame = -3

Query: 468 LAPEVDLWVVAKNLPGWTGAELAQLLQEGAMMAVRNGHPHIVQKDLDLAVDRITVGPQRF 289
+ P+V L +A+ PG++GA+LA LL E A++ R + ++D ++DR+ G +
Sbjct: 361 MEPKVSLETIARRTPGFSGADLANLLNEAAILTARRRKNAMTMSEIDTSIDRVVAGME-- 418

Query: 288 GVDRGLPV-----HRRMATLEVGLAMTTHILRRLEGAKLEYCERVSIVPRGETLSRTIFQ 124
G P+ R +A EVG A+ +L + ++V+++PRG+ T F
Sbjct: 419 ----GTPLIDSKSKRLIAYHEVGHAIIGSLLEHHDPV-----QKVTLIPRGQARGLTWFT 469

Query: 123 RLDDEGYFFEARPQLLHRLQLFLGGRAAED 34
DD+ +R Q+L R+ LGGRAAE+
Sbjct: 470 PSDDQSLI--SRSQILARIVGALGGRAAEE 497


>sp|O78516|FTSH_GUITH Cell division protease ftsH homolog
OS=Guillardia theta GN=ftsH PE=3 SV=1
Length = 631

Score = 69.3 bits (168), Expect = 8e-12
Identities = 47/142 (33%), Positives = 78/142 (54%), Gaps = 1/142 (0%)
Frame = -3

Query: 456 VDLWVVAKNLPGWTGAELAQLLQEGAMMAVRNGHPHIVQKDLDLAVDRITVGPQ-RFGVD 280
+ L ++AK PG++GA+LA LL E A++ R I ++D ++DR+ G + + VD
Sbjct: 365 ISLELIAKRTPGFSGADLANLLNEAAILTARRRKKQITISEIDASIDRVIAGMEGKALVD 424

Query: 279 RGLPVHRRMATLEVGLAMTTHILRRLEGAKLEYCERVSIVPRGETLSRTIFQRLDDEGYF 100
R +A EVG A+ +L+ + ++V++VPRG+ T F +D+
Sbjct: 425 S--KTKRLIAYHEVGHAIIGTLLKHHDPV-----QKVTLVPRGQAKGLTWFTPSEDQSLI 477

Query: 99 FEARPQLLHRLQLFLGGRAAED 34
+R Q+L R+ LGGRAAE+
Sbjct: 478 --SRSQILARIMGALGGRAAEE 497


>sp|O80983|FTSH4_ARATH Cell division protease ftsH homolog 4,
mitochondrial OS=Arabidopsis thaliana GN=FTSH4 PE=1 SV=2
Length = 717

Score = 69.3 bits (168), Expect = 8e-12
Identities = 48/144 (33%), Positives = 76/144 (52%)
Frame = -3

Query: 465 APEVDLWVVAKNLPGWTGAELAQLLQEGAMMAVRNGHPHIVQKDLDLAVDRITVGPQRFG 286
A +VDL ++A+ PG++GA+LA L+ A+ A +G + DL+ A DRI +G +R
Sbjct: 413 AEDVDLMIIARGTPGFSGADLANLVNVAALKAAMDGSKDVTMSDLEFAKDRIMMGSERKS 472

Query: 285 VDRGLPVHRRMATLEVGLAMTTHILRRLEGAKLEYCERVSIVPRGETLSRTIFQRLDDEG 106
+ A E G A+ + EGA + + +IVPRG L + +L D+
Sbjct: 473 AVISDESRKLTAFHEGGHAL---VAIHTEGALPVH--KATIVPRGMALG--MVSQLPDKD 525

Query: 105 YFFEARPQLLHRLQLFLGGRAAED 34
+R Q+L RL + +GGR AE+
Sbjct: 526 ETSISRKQMLARLDVCMGGRVAEE 549


>sp|P51327|FTSH_PORPU Cell division protease ftsH homolog
OS=Porphyra purpurea GN=ftsH PE=3 SV=1
Length = 628

Score = 68.2 bits (165), Expect = 2e-11
Identities = 46/147 (31%), Positives = 77/147 (52%), Gaps = 5/147 (3%)
Frame = -3

Query: 459 EVDLWVVAKNLPGWTGAELAQLLQEGAMMAVRNGHPHIVQKDLDLAVDRITVGPQRFGVD 280
+V L +A+ PG++GA+LA LL E A++ R + ++D ++DR+ G +
Sbjct: 364 KVSLETIARRTPGFSGADLANLLNEAAILTARRRKSAMTMSEIDTSIDRVVAGLE----- 418

Query: 279 RGLPV-----HRRMATLEVGLAMTTHILRRLEGAKLEYCERVSIVPRGETLSRTIFQRLD 115
G P+ R +A EVG A+ +L + ++V+++PRG+ T F D
Sbjct: 419 -GTPLIDSKSKRLIAYHEVGHAIIGSLLEHHDPV-----QKVTLIPRGQARGLTWFTPSD 472

Query: 114 DEGYFFEARPQLLHRLQLFLGGRAAED 34
D+ +R Q+L R+ LGGRAAE+
Sbjct: 473 DQSLI--SRSQILARIVGALGGRAAEE 497


>sp|Q655S1|FTSH2_ORYSJ Cell division protease ftsH homolog 2,
chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH2
PE=3 SV=1
Length = 676

Score = 67.8 bits (164), Expect = 2e-11
Identities = 47/146 (32%), Positives = 73/146 (50%), Gaps = 4/146 (2%)
Frame = -3

Query: 459 EVDLWVVAKNLPGWTGAELAQLLQEGAMMAVRNGHPHIVQKDLDLAVDRITVGPQ----R 292
+V L V+A PG++GA+LA LL E A++A R G I K++D ++DRI G +
Sbjct: 405 DVSLEVIAMRTPGFSGADLANLLNEAAILAGRRGRTAISSKEIDDSIDRIVAGMEGTVMT 464

Query: 291 FGVDRGLPVHRRMATLEVGLAMTTHILRRLEGAKLEYCERVSIVPRGETLSRTIFQRLDD 112
G + L + + G H + ++V+++PRG+ T F +DD
Sbjct: 465 DGKSKSLVAYHEVGHAICGTLTPGH----------DPVQKVTLIPRGQARGLTWFIPMDD 514

Query: 111 EGYFFEARPQLLHRLQLFLGGRAAED 34
+R QL R+ LGGRAAE+
Sbjct: 515 PTLI--SRQQLFARIVGGLGGRAAEE 538


>sp|P37476|FTSH_BACSU Cell division protease ftsH homolog
OS=Bacillus subtilis GN=ftsH PE=3 SV=1
Length = 637

Score = 67.4 bits (163), Expect = 3e-11
Identities = 43/146 (29%), Positives = 72/146 (49%), Gaps = 5/146 (3%)
Frame = -3

Query: 456 VDLWVVAKNLPGWTGAELAQLLQEGAMMAVRNGHPHIVQKDLDLAVDRITVGPQRFG--- 286
V+L +A PG++GA+L LL E A++A R I +D+D A DR+ GP +
Sbjct: 353 VNLKSIAMRTPGFSGADLENLLNEAALVAARQNKKKIDARDIDEATDRVIAGPAKKSRVI 412

Query: 285 --VDRGLPVHRRMATLEVGLAMTTHILRRLEGAKLEYCERVSIVPRGETLSRTIFQRLDD 112
+R + + +GL + + + +V+IVPRG+ + L
Sbjct: 413 SKKERNIVAYHEGGHTVIGLVLD----------EADMVHKVTIVPRGQAGGYAVM--LPR 460

Query: 111 EGYFFEARPQLLHRLQLFLGGRAAED 34
E +F+ +P+LL ++ LGGR AE+
Sbjct: 461 EDRYFQTKPELLDKIVGLLGGRVAEE 486


tr_hit_id A7PSH2
Definition tr|A7PSH2|A7PSH2_VITVI Chromosome chr6 scaffold_28, whole genome shotgun sequence OS=Vitis vinifera
Align length 147
Score (bit) 191.0
E-value 2.0e-47
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916114|Adiantum capillus-veneris mRNA, clone:
YMU001_000083_C10.
(470 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PSH2|A7PSH2_VITVI Chromosome chr6 scaffold_28, whole genome... 191 2e-47
tr|A9RJ05|A9RJ05_PHYPA Predicted protein OS=Physcomitrella paten... 179 5e-44
tr|A9SRQ7|A9SRQ7_PHYPA Predicted protein OS=Physcomitrella paten... 176 5e-43
tr|O22993|O22993_ARATH Cell division protein isolog (Cell divisi... 175 1e-42
tr|Q47KU4|Q47KU4_THEFY Mername-AA223 peptidase. Metallo peptidas... 87 3e-16
tr|Q00YT8|Q00YT8_OSTTA COG0465: ATP-dependent Zn proteases (ISS)... 87 4e-16
tr|Q72IK4|Q72IK4_THET2 Cell division protein ftsH OS=Thermus the... 85 2e-15
tr|Q5SI82|Q5SI82_THET8 Cell division protein FtsH OS=Thermus the... 85 2e-15
tr|Q9LCZ4|Q9LCZ4_THETH FtsH OS=Thermus thermophilus GN=ftsH PE=1... 85 2e-15
tr|A4S4T7|A4S4T7_OSTLU Predicted protein (Fragment) OS=Ostreococ... 85 2e-15
tr|Q67T82|Q67T82_SYMTH Cell division protein OS=Symbiobacterium ... 84 4e-15
tr|Q2J4Y2|Q2J4Y2_FRASC Mername-AA223 peptidase. Metallo peptidas... 84 5e-15
tr|Q0RBH5|Q0RBH5_FRAAA Cell division protein FtsH (ATP-dependent... 84 5e-15
tr|A8UWH5|A8UWH5_9AQUI Tryptophan synthase subunit beta OS=Hydro... 84 5e-15
tr|Q9WZ49|Q9WZ49_THEMA Cell division protein FtsH OS=Thermotoga ... 83 8e-15
tr|B1L8R4|B1L8R4_THESQ ATP-dependent metalloprotease FtsH OS=The... 83 8e-15
tr|Q8DKW7|Q8DKW7_THEEB Cell division protein OS=Thermosynechococ... 82 1e-14
tr|Q67JH0|Q67JH0_SYMTH Cell division protein OS=Symbiobacterium ... 82 1e-14
tr|A5IJJ4|A5IJJ4_THEP1 ATP-dependent metalloprotease FtsH OS=The... 82 2e-14
tr|B7RBC4|B7RBC4_9THEM Cell division protein FtsH OS=Marinitoga ... 82 2e-14
tr|B4U7U4|B4U7U4_HYDS0 ATP-dependent metalloprotease FtsH OS=Hyd... 81 3e-14
tr|A0LRB8|A0LRB8_ACIC1 Mername-AA223 peptidase. Metallo peptidas... 81 3e-14
tr|A8LDZ9|A8LDZ9_FRASN ATP-dependent metalloprotease FtsH OS=Fra... 80 4e-14
tr|Q0YIN3|Q0YIN3_9DELT ATP-dependent metalloprotease FtsH OS=Geo... 80 4e-14
tr|B2KEC6|B2KEC6_ELUMP ATP-dependent metalloprotease FtsH OS=Elu... 80 5e-14
tr|Q8G3S2|Q8G3S2_BIFLO ATP-dependent zinc metallopeptidase invol... 79 1e-13
tr|B3DR10|B3DR10_BIFLD ATP-dependent Zn protease OS=Bifidobacter... 79 1e-13
tr|B7GP50|B7GP50_BIFLO ATP-dependent metalloprotease FtsH OS=Bif... 79 1e-13
tr|Q2S1J9|Q2S1J9_SALRD Cell division protein FtsH OS=Salinibacte... 79 1e-13
tr|A8YXJ2|A8YXJ2_LACH4 Cell division protein OS=Lactobacillus he... 79 1e-13

>tr|A7PSH2|A7PSH2_VITVI Chromosome chr6 scaffold_28, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00022916001
PE=4 SV=1
Length = 901

Score = 191 bits (484), Expect = 2e-47
Identities = 93/147 (63%), Positives = 115/147 (78%)
Frame = -3

Query: 468 LAPEVDLWVVAKNLPGWTGAELAQLLQEGAMMAVRNGHPHIVQKDLDLAVDRITVGPQRF 289
LA VDL A+NLPGWTGA LAQLLQE A++AVR GH I+Q D+D AVDR+TVGP+R
Sbjct: 585 LAESVDLSTYAQNLPGWTGARLAQLLQEAALVAVRKGHEAILQSDVDEAVDRLTVGPKRV 644

Query: 288 GVDRGLPVHRRMATLEVGLAMTTHILRRLEGAKLEYCERVSIVPRGETLSRTIFQRLDDE 109
G++ G R AT EVG A+T+H+LRR E AK+E C+R+S++PRG+TLS+ +F RLDDE
Sbjct: 645 GIELGHQGQCRRATTEVGTAITSHLLRRYESAKVERCDRISVIPRGQTLSQVVFDRLDDE 704

Query: 108 GYFFEARPQLLHRLQLFLGGRAAEDGI 28
Y FE RPQLLHRLQ+ LGGRAAE+ I
Sbjct: 705 SYMFERRPQLLHRLQVLLGGRAAEEVI 731


>tr|A9RJ05|A9RJ05_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_175333 PE=4 SV=1
Length = 958

Score = 179 bits (455), Expect = 5e-44
Identities = 88/141 (62%), Positives = 112/141 (79%)
Frame = -3

Query: 456 VDLWVVAKNLPGWTGAELAQLLQEGAMMAVRNGHPHIVQKDLDLAVDRITVGPQRFGVDR 277
V+L AKNLPGW+GAELAQLLQE A++AVR+G I + D+D A+DR+T+GP+R G+ R
Sbjct: 619 VNLESYAKNLPGWSGAELAQLLQEAALVAVRHGGTIIERIDMDRALDRLTMGPERIGMRR 678

Query: 276 GLPVHRRMATLEVGLAMTTHILRRLEGAKLEYCERVSIVPRGETLSRTIFQRLDDEGYFF 97
LPVHRRMA E+G+A+T+H+LR E A E+C+RVSIVPRG+TL+R I RL+DE Y F
Sbjct: 679 RLPVHRRMAAHELGIALTSHLLRHFEQADTEFCDRVSIVPRGDTLARCIMNRLEDEYYLF 738

Query: 96 EARPQLLHRLQLFLGGRAAED 34
E RP LLHRLQ+ LGGRA E+
Sbjct: 739 ERRPALLHRLQVLLGGRAGEE 759


>tr|A9SRQ7|A9SRQ7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_187682 PE=4 SV=1
Length = 966

Score = 176 bits (446), Expect = 5e-43
Identities = 85/145 (58%), Positives = 113/145 (77%)
Frame = -3

Query: 468 LAPEVDLWVVAKNLPGWTGAELAQLLQEGAMMAVRNGHPHIVQKDLDLAVDRITVGPQRF 289
L V+L AKNLPGW+GAELAQLLQE A++AVR+G + + D+D A+DR+T+GP+R
Sbjct: 618 LDESVNLESYAKNLPGWSGAELAQLLQEAALVAVRHGGTIVERIDMDRALDRLTMGPERI 677

Query: 288 GVDRGLPVHRRMATLEVGLAMTTHILRRLEGAKLEYCERVSIVPRGETLSRTIFQRLDDE 109
G+ R LPVHRRMA E+G+A+T+H+LR E + E+C+RVSIVPRG+TL+R I RL+DE
Sbjct: 678 GMRRRLPVHRRMAAHELGIALTSHLLRHFEQSDTEFCDRVSIVPRGDTLARCIMNRLEDE 737

Query: 108 GYFFEARPQLLHRLQLFLGGRAAED 34
Y F+ +P LLHRLQ+ LGGRA E+
Sbjct: 738 YYLFQRKPALLHRLQVLLGGRAGEE 762


>tr|O22993|O22993_ARATH Cell division protein isolog (Cell division
protein-like) OS=Arabidopsis thaliana GN=AT4g23940 PE=2
SV=1
Length = 946

Score = 175 bits (443), Expect = 1e-42
Identities = 87/147 (59%), Positives = 111/147 (75%)
Frame = -3

Query: 468 LAPEVDLWVVAKNLPGWTGAELAQLLQEGAMMAVRNGHPHIVQKDLDLAVDRITVGPQRF 289
++ VDL A NLPGW+GA+LAQL+QE A++AVR H I+Q D+D AVDR+TVGP R
Sbjct: 626 MSDSVDLSSYASNLPGWSGAKLAQLVQEAALVAVRKTHNSILQSDMDDAVDRLTVGPTRI 685

Query: 288 GVDRGLPVHRRMATLEVGLAMTTHILRRLEGAKLEYCERVSIVPRGETLSRTIFQRLDDE 109
G++ G R AT EVG+A+T+H+L R E AK+E C+RVSI+PRG+TLS+ +F RLDDE
Sbjct: 686 GLELGHQGQCRRATTEVGVAITSHLLLRYENAKIERCDRVSIIPRGQTLSQVVFHRLDDE 745

Query: 108 GYFFEARPQLLHRLQLFLGGRAAEDGI 28
Y F PQLLHRLQ+ LGGRAAE+ I
Sbjct: 746 SYMFGRLPQLLHRLQVLLGGRAAEEVI 772


>tr|Q47KU4|Q47KU4_THEFY Mername-AA223 peptidase. Metallo peptidase.
MEROPS family M41 OS=Thermobifida fusca (strain YX)
GN=Tfu_2895 PE=3 SV=1
Length = 682

Score = 87.4 bits (215), Expect = 3e-16
Identities = 52/145 (35%), Positives = 80/145 (55%)
Frame = -3

Query: 468 LAPEVDLWVVAKNLPGWTGAELAQLLQEGAMMAVRNGHPHIVQKDLDLAVDRITVGPQRF 289
L P+VDL V+A+ PG+TGA+LA ++ EGA++ R G I L+ A+DR+ GP+R
Sbjct: 352 LGPDVDLDVIARRTPGFTGADLANVINEGALLTARRGKQQIDMATLEEAIDRVIAGPERK 411

Query: 288 GVDRGLPVHRRMATLEVGLAMTTHILRRLEGAKLEYCERVSIVPRGETLSRTIFQRLDDE 109
+ +A E G A+ H L + +V+I+PRG L T+ L E
Sbjct: 412 SRVMSEAEKKIIAYHEGGHALVGHALPNADPV-----HKVTILPRGRALGYTM--SLPTE 464

Query: 108 GYFFEARPQLLHRLQLFLGGRAAED 34
F +R +++ +L + LGGRAAE+
Sbjct: 465 DKFLTSRSEMMDQLAMMLGGRAAEE 489


>tr|Q00YT8|Q00YT8_OSTTA COG0465: ATP-dependent Zn proteases (ISS)
(Fragment) OS=Ostreococcus tauri GN=Ot11g02160 PE=4 SV=1
Length = 885

Score = 87.0 bits (214), Expect = 4e-16
Identities = 51/142 (35%), Positives = 80/142 (56%)
Frame = -3

Query: 462 PEVDLWVVAKNLPGWTGAELAQLLQEGAMMAVRNGHPHIVQKDLDLAVDRITVGPQRFGV 283
PE+D +A+NLPG +GAE+A + E A+ VR I + D+ AV+R+ G +
Sbjct: 373 PEIDTKRLAQNLPGLSGAEIANICNEAAVHCVRRNGEQIEEFDVLNAVERVVSGIRLSPH 432

Query: 282 DRGLPVHRRMATLEVGLAMTTHILRRLEGAKLEYCERVSIVPRGETLSRTIFQRLDDEGY 103
+ P+ R++A EVG A+ ++L + G +E E +SI+PRG + T+ QR DE Y
Sbjct: 433 PKDAPLTRKLAAHEVGHALVQNLLHKSTGL-IENIELISIIPRGFEPTITLIQRKRDEEY 491

Query: 102 FFEARPQLLHRLQLFLGGRAAE 37
+ R + R+Q+ L GR E
Sbjct: 492 QYPTRARYCERVQVLLAGRTCE 513


>tr|Q72IK4|Q72IK4_THET2 Cell division protein ftsH OS=Thermus
thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)
GN=ftsH PE=4 SV=1
Length = 624

Score = 85.1 bits (209), Expect = 2e-15
Identities = 54/145 (37%), Positives = 78/145 (53%)
Frame = -3

Query: 468 LAPEVDLWVVAKNLPGWTGAELAQLLQEGAMMAVRNGHPHIVQKDLDLAVDRITVGPQRF 289
LA +VDL ++AK PG+ GA+L LL E A++A R G I KDL+ A DR+ +GP +
Sbjct: 344 LAEDVDLALLAKRTPGFVGADLENLLNEAALLAAREGRRKITMKDLEEAADRVMMGPAKK 403

Query: 288 GVDRGLPVHRRMATLEVGLAMTTHILRRLEGAKLEYCERVSIVPRGETLSRTIFQRLDDE 109
+ R A E G A+ H L +G +V+IVPRG L + +R E
Sbjct: 404 SLVLSPRDRRITAYHEAGHALAAHFLEHADGV-----HKVTIVPRGRALGFMMPRR---E 455

Query: 108 GYFFEARPQLLHRLQLFLGGRAAED 34
+R +LL ++ + L GRAAE+
Sbjct: 456 DMLHWSRKRLLDQIAVALAGRAAEE 480


>tr|Q5SI82|Q5SI82_THET8 Cell division protein FtsH OS=Thermus
thermophilus (strain HB8 / ATCC 27634 / DSM 579)
GN=TTHA1492 PE=4 SV=1
Length = 624

Score = 85.1 bits (209), Expect = 2e-15
Identities = 54/145 (37%), Positives = 78/145 (53%)
Frame = -3

Query: 468 LAPEVDLWVVAKNLPGWTGAELAQLLQEGAMMAVRNGHPHIVQKDLDLAVDRITVGPQRF 289
LA +VDL ++AK PG+ GA+L LL E A++A R G I KDL+ A DR+ +GP +
Sbjct: 344 LAEDVDLALLAKRTPGFVGADLENLLNEAALLAAREGRRKITMKDLEEAADRVMMGPAKK 403

Query: 288 GVDRGLPVHRRMATLEVGLAMTTHILRRLEGAKLEYCERVSIVPRGETLSRTIFQRLDDE 109
+ R A E G A+ H L +G +V+IVPRG L + +R E
Sbjct: 404 SLVLSPRDRRITAYHEAGHALAAHFLEHADGV-----HKVTIVPRGRALGFMMPRR---E 455

Query: 108 GYFFEARPQLLHRLQLFLGGRAAED 34
+R +LL ++ + L GRAAE+
Sbjct: 456 DMLHWSRKRLLDQIAVALAGRAAEE 480


>tr|Q9LCZ4|Q9LCZ4_THETH FtsH OS=Thermus thermophilus GN=ftsH PE=1
SV=1
Length = 624

Score = 85.1 bits (209), Expect = 2e-15
Identities = 54/145 (37%), Positives = 78/145 (53%)
Frame = -3

Query: 468 LAPEVDLWVVAKNLPGWTGAELAQLLQEGAMMAVRNGHPHIVQKDLDLAVDRITVGPQRF 289
LA +VDL ++AK PG+ GA+L LL E A++A R G I KDL+ A DR+ +GP +
Sbjct: 344 LAEDVDLALLAKRTPGFVGADLENLLNEAALLAAREGRRKITMKDLEEAADRVMMGPAKK 403

Query: 288 GVDRGLPVHRRMATLEVGLAMTTHILRRLEGAKLEYCERVSIVPRGETLSRTIFQRLDDE 109
+ R A E G A+ H L +G +V+IVPRG L + +R E
Sbjct: 404 SLVLSPRDRRITAYHEAGHALAAHFLEHADGV-----HKVTIVPRGRALGFMMPRR---E 455

Query: 108 GYFFEARPQLLHRLQLFLGGRAAED 34
+R +LL ++ + L GRAAE+
Sbjct: 456 DMLHWSRKRLLDQIAVALAGRAAEE 480


>tr|A4S4T7|A4S4T7_OSTLU Predicted protein (Fragment) OS=Ostreococcus
lucimarinus (strain CCE9901) GN=OSTLU_44098 PE=4 SV=1
Length = 494

Score = 85.1 bits (209), Expect = 2e-15
Identities = 50/142 (35%), Positives = 80/142 (56%)
Frame = -3

Query: 462 PEVDLWVVAKNLPGWTGAELAQLLQEGAMMAVRNGHPHIVQKDLDLAVDRITVGPQRFGV 283
PE+D +A+NLPG +GAE+A + E A+ VR I + D+ AV+R+ G +
Sbjct: 246 PEIDTKRLAQNLPGLSGAEIANICNEAAVHCVRRQGEQIEEHDVLDAVERVVSGIRLTAH 305

Query: 282 DRGLPVHRRMATLEVGLAMTTHILRRLEGAKLEYCERVSIVPRGETLSRTIFQRLDDEGY 103
+ R++A EVG A+ ++L + G +E E +SI+PRG + T+ QR DE Y
Sbjct: 306 PKESVTTRKLAAHEVGHALVQNLLHKSNGL-IEDIEMISIIPRGFEPAITLIQRKRDEDY 364

Query: 102 FFEARPQLLHRLQLFLGGRAAE 37
+ R ++ R+Q+ L GR+ E
Sbjct: 365 RYPTRARMCERVQVLLAGRSCE 386