BP916125
Clone id YMU001_000083_D11
Library
Length 262
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000083_D11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GTCCTATAATGTCATAAGGGAACATGTGATCACACTGCCATAGAGTGGCCTAGGTACACT
TGTAGAACCATTTAGTTGAGCACCCTTCGGATCTAGGACCACATGGTTTAACATAGAGGT
GACTCTATGGCCCTAGGTCCATATGGATGTAATAATATCCATCTTGTCTAAATATATGTC
ATACTTCTTACAGAAAATGTCTCAAAAGAGACAGCCAAAGTCATGTTGATGCAACAGGCT
CATTCACTTACCAAATGGTGGA
■■Homology search results ■■ -
sp_hit_id Q7MUI9
Definition sp|Q7MUI9|MEND_PORGI 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1- carboxylate synthase OS=Porphyromonas gingivalis
Align length 54
Score (bit) 29.3
E-value 6.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916125|Adiantum capillus-veneris mRNA, clone:
YMU001_000083_D11.
(262 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q7MUI9|MEND_PORGI 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cycloh... 29 6.5

>sp|Q7MUI9|MEND_PORGI
2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-
carboxylate synthase OS=Porphyromonas gingivalis GN=menD
PE=3 SV=1
Length = 577

Score = 29.3 bits (64), Expect = 6.5
Identities = 16/54 (29%), Positives = 26/54 (48%)
Frame = -2

Query: 195 FCKKYDIYLDKMDIITSIWT*GHRVTSMLNHVVLDPKGAQLNGSTSVPRPLYGS 34
F K Y + D S W R+ +LNH ++ P+ ++ + S PLYG+
Sbjct: 129 FVKSYCSLRAEFDTSASAWYANRRLNEVLNHALM-PRRGPVHINMSFCEPLYGT 181


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916125|Adiantum capillus-veneris mRNA, clone:
YMU001_000083_D11.
(262 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******