BP916130
Clone id YMU001_000083_E04
Library
Length 323
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000083_E04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GTCATACGATCTGATGGCTATGAGCATTTGAAAGAGAGCTGCCCTTCATTGCAATGTGAA
CTTTTGAAAGCTGTTGCTGGTGTCGAGGTTGATGCCGAGGTGGAGATTCCAGTTGTTGTG
AACAAGAAGGCAATCATAGAGGTACCCGCTTTAGACGGAGCAGATGCCAATGGCAGAAGA
GTGAGGTCCAGAGCCTAATGTGTGGAAGAAGTAGCTTTGTGCTAACTTGATGGATTAGTA
GGCTTGGAGAAACTGACCTAGTTCTGTGGAACTTCATTTGCTATGGCATTATCCACTGCT
TTATTTGTAGCTCTGAGGTTGTA
■■Homology search results ■■ -
sp_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916130|Adiantum capillus-veneris mRNA, clone:
YMU001_000083_E04.
(323 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done

***** No hits found ******


tr_hit_id A9TCQ8
Definition tr|A9TCQ8|A9TCQ8_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 64
Score (bit) 48.5
E-value 0.0002
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916130|Adiantum capillus-veneris mRNA, clone:
YMU001_000083_E04.
(323 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TCQ8|A9TCQ8_PHYPA Predicted protein OS=Physcomitrella paten... 49 2e-04
tr|A9T0Y5|A9T0Y5_PHYPA Predicted protein OS=Physcomitrella paten... 48 3e-04
tr|A9TWM0|A9TWM0_PHYPA Predicted protein OS=Physcomitrella paten... 47 4e-04
tr|A9NUQ7|A9NUQ7_PICSI Putative uncharacterized protein OS=Picea... 45 0.002
tr|B4FQ32|B4FQ32_MAIZE Putative uncharacterized protein OS=Zea m... 44 0.004
tr|A7PU55|A7PU55_VITVI Chromosome chr7 scaffold_31, whole genome... 44 0.005
tr|B6TPG4|B6TPG4_MAIZE Speckle-type POZ protein OS=Zea mays PE=2... 43 0.007
tr|B4FNG2|B4FNG2_MAIZE Putative uncharacterized protein OS=Zea m... 43 0.007
tr|B4F9H2|B4F9H2_MAIZE Putative uncharacterized protein OS=Zea m... 43 0.007
tr|Q8L765|Q8L765_ARATH Putative uncharacterized protein At5g1900... 43 0.009
tr|Q852K2|Q852K2_ORYSJ Expressed protein OS=Oryza sativa subsp. ... 42 0.012
tr|Q84VC1|Q84VC1_ORYSJ Zinc finger POZ domain protein (Fragment)... 42 0.012
tr|Q10C73|Q10C73_ORYSJ Os03g0792500 protein OS=Oryza sativa subs... 42 0.012
tr|B6TJ67|B6TJ67_MAIZE Speckle-type POZ protein OS=Zea mays PE=2... 42 0.012
tr|A3ANI2|A3ANI2_ORYSJ Putative uncharacterized protein OS=Oryza... 42 0.012
tr|A2XMT4|A2XMT4_ORYSI Putative uncharacterized protein OS=Oryza... 42 0.012
tr|Q8LI88|Q8LI88_ORYSJ Os07g0167200 protein OS=Oryza sativa subs... 42 0.015
tr|Q8H3E5|Q8H3E5_ORYSJ Os07g0655300 protein OS=Oryza sativa subs... 42 0.015
tr|B8B7L7|B8B7L7_ORYSI Putative uncharacterized protein OS=Oryza... 42 0.015
tr|B8B5D4|B8B5D4_ORYSI Putative uncharacterized protein OS=Oryza... 42 0.015
tr|A3BGX7|A3BGX7_ORYSJ Putative uncharacterized protein OS=Oryza... 42 0.015
tr|B4FFE1|B4FFE1_MAIZE Putative uncharacterized protein OS=Zea m... 42 0.020
tr|A7NWE2|A7NWE2_VITVI Chromosome chr5 scaffold_2, whole genome ... 41 0.034
tr|A7PG96|A7PG96_VITVI Chromosome chr6 scaffold_15, whole genome... 40 0.044
tr|Q9M8J9|Q9M8J9_ARATH F28L1.13 protein OS=Arabidopsis thaliana ... 40 0.058
tr|B6TV51|B6TV51_MAIZE Speckle-type POZ protein OS=Zea mays PE=2... 40 0.058
tr|B4FTH6|B4FTH6_MAIZE Putative uncharacterized protein OS=Zea m... 39 0.098
tr|Q9SRV1|Q9SRV1_ARATH F20H23.23 protein (AT3g03740/F20H23_23) O... 39 0.13
tr|Q8LGI9|Q8LGI9_ARATH Putative uncharacterized protein OS=Arabi... 39 0.13
tr|B0FUP7|B0FUP7_ARALY At3g03740-like protein (Fragment) OS=Arab... 39 0.13

>tr|A9TCQ8|A9TCQ8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_143618 PE=4 SV=1
Length = 396

Score = 48.5 bits (114), Expect = 2e-04
Identities = 27/64 (42%), Positives = 37/64 (57%)
Frame = +1

Query: 1 VIRSDGYEHLKESCPSLQCELLKXXXXXXXXXXXXIPVVVNKKAIIEVPALDGADANGRR 180
V+ S+G+E+L++SCP+LQ ELLK V+ N+ + DGADA GRR
Sbjct: 333 VMHSEGFEYLRDSCPTLQSELLK-TVAGVYEEGVGTGVISNRNRSVWGQMSDGADAGGRR 391

Query: 181 VRSR 192
VR R
Sbjct: 392 VRPR 395


>tr|A9T0Y5|A9T0Y5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_217835 PE=4 SV=1
Length = 402

Score = 47.8 bits (112), Expect = 3e-04
Identities = 26/64 (40%), Positives = 38/64 (59%)
Frame = +1

Query: 1 VIRSDGYEHLKESCPSLQCELLKXXXXXXXXXXXXIPVVVNKKAIIEVPALDGADANGRR 180
V++S+G+E+L++SCP+LQ ELLK V+ N+ + DG DA+GRR
Sbjct: 339 VMQSEGFEYLRDSCPTLQSELLK-TVAGVCEESVVTGVISNRNRSVWGQLSDGTDASGRR 397

Query: 181 VRSR 192
VR R
Sbjct: 398 VRPR 401


>tr|A9TWM0|A9TWM0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_226178 PE=4 SV=1
Length = 401

Score = 47.4 bits (111), Expect = 4e-04
Identities = 27/64 (42%), Positives = 36/64 (56%)
Frame = +1

Query: 1 VIRSDGYEHLKESCPSLQCELLKXXXXXXXXXXXXIPVVVNKKAIIEVPALDGADANGRR 180
V+ S+G+E+L++SCP+LQ ELLK V N+ + DGADA GRR
Sbjct: 338 VMHSEGFEYLRDSCPTLQSELLK-TVAGVYEEGVGTGVTSNRNRSVWGQLSDGADAGGRR 396

Query: 181 VRSR 192
VR R
Sbjct: 397 VRPR 400


>tr|A9NUQ7|A9NUQ7_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 411

Score = 44.7 bits (104), Expect = 0.002
Identities = 27/64 (42%), Positives = 31/64 (48%)
Frame = +1

Query: 1 VIRSDGYEHLKESCPSLQCELLKXXXXXXXXXXXXIPVVVNKKAIIEVPALDGADANGRR 180
V+RS G+E+LKE CP LQ ELLK K + DG D NGRR
Sbjct: 352 VMRSKGFEYLKEKCPLLQSELLKTVAHFEDDCSSG-----GKTRSVWAQLSDGTDINGRR 406

Query: 181 VRSR 192
VR R
Sbjct: 407 VRPR 410


>tr|B4FQ32|B4FQ32_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 428

Score = 43.9 bits (102), Expect = 0.004
Identities = 23/64 (35%), Positives = 35/64 (54%)
Frame = +1

Query: 1 VIRSDGYEHLKESCPSLQCELLKXXXXXXXXXXXXIPVVVNKKAIIEVPALDGADANGRR 180
VIR++G+++LK++CPSLQ E+L+ + K + DG D +GRR
Sbjct: 369 VIRTEGFDYLKDNCPSLQSEILRTVAGCEEPCSSGL-----KSQSVWAQLSDGGDTSGRR 423

Query: 181 VRSR 192
VR R
Sbjct: 424 VRPR 427


>tr|A7PU55|A7PU55_VITVI Chromosome chr7 scaffold_31, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00023662001
PE=4 SV=1
Length = 171

Score = 43.5 bits (101), Expect = 0.005
Identities = 26/64 (40%), Positives = 37/64 (57%)
Frame = +1

Query: 1 VIRSDGYEHLKESCPSLQCELLKXXXXXXXXXXXXIPVVVNKKAIIEVPALDGADANGRR 180
V+++DG+E+LKESCPS+ ELL+ V+V + LDG+D NGRR
Sbjct: 114 VMQTDGFEYLKESCPSVLTELLEYVARVSEH-----SVIVCRHG--NEAILDGSDINGRR 166

Query: 181 VRSR 192
V+ R
Sbjct: 167 VKQR 170


>tr|B6TPG4|B6TPG4_MAIZE Speckle-type POZ protein OS=Zea mays PE=2
SV=1
Length = 422

Score = 43.1 bits (100), Expect = 0.007
Identities = 23/64 (35%), Positives = 34/64 (53%)
Frame = +1

Query: 1 VIRSDGYEHLKESCPSLQCELLKXXXXXXXXXXXXIPVVVNKKAIIEVPALDGADANGRR 180
V+++DG+++L++SCPSL ELL+ + LDG DANGRR
Sbjct: 366 VMQTDGFDYLQQSCPSLLTELLEYVAKAGEHSV--------SPCLYSTEVLDGGDANGRR 417

Query: 181 VRSR 192
V+ R
Sbjct: 418 VKPR 421


>tr|B4FNG2|B4FNG2_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 426

Score = 43.1 bits (100), Expect = 0.007
Identities = 23/64 (35%), Positives = 34/64 (53%)
Frame = +1

Query: 1 VIRSDGYEHLKESCPSLQCELLKXXXXXXXXXXXXIPVVVNKKAIIEVPALDGADANGRR 180
V+++DG+++L++SCPSL ELL+ + LDG DANGRR
Sbjct: 370 VMQTDGFDYLQQSCPSLLTELLEYVAKIGEHSV--------SPCLYSTEVLDGGDANGRR 421

Query: 181 VRSR 192
V+ R
Sbjct: 422 VKPR 425


>tr|B4F9H2|B4F9H2_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 422

Score = 43.1 bits (100), Expect = 0.007
Identities = 23/64 (35%), Positives = 34/64 (53%)
Frame = +1

Query: 1 VIRSDGYEHLKESCPSLQCELLKXXXXXXXXXXXXIPVVVNKKAIIEVPALDGADANGRR 180
V+++DG+++L++SCPSL ELL+ + LDG DANGRR
Sbjct: 366 VMQTDGFDYLQQSCPSLLTELLEYVAKAGEHSV--------SPCLYSTEVLDGGDANGRR 417

Query: 181 VRSR 192
V+ R
Sbjct: 418 VKPR 421


>tr|Q8L765|Q8L765_ARATH Putative uncharacterized protein At5g19000
OS=Arabidopsis thaliana GN=At5g19000 PE=2 SV=1
Length = 407

Score = 42.7 bits (99), Expect = 0.009
Identities = 26/64 (40%), Positives = 38/64 (59%)
Frame = +1

Query: 1 VIRSDGYEHLKESCPSLQCELLKXXXXXXXXXXXXIPVVVNKKAIIEVPALDGADANGRR 180
V+++DG+++LKESCPSL ELL+ + V ++K I DG DA+GRR
Sbjct: 349 VMQTDGFDYLKESCPSLLTELLQ---YVARLSEHSVIVSGHRKEIF----ADGCDASGRR 401

Query: 181 VRSR 192
V+ R
Sbjct: 402 VKPR 405