BP916132
Clone id YMU001_000083_E06
Library
Length 184
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000083_E06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GTCTGAAACAAATCAGGTGAACTTGAAACCACAAGTGGTCCATTGTAGATATATGGGCCT
GAGTTACGGATAACCAATGTTGGTTCATGAGGAACAGCAGGGACGTGTTGGTCAAGCAGT
CAACAGCTTGAGAGGTGCCATTGCATGCCAAGCTAGAAAGAACAGTAAAAAAGTTGCACA
CAAT
■■Homology search results ■■ -
sp_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916132|Adiantum capillus-veneris mRNA, clone:
YMU001_000083_E06.
(184 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done

***** No hits found ******


tr_hit_id Q2GCS6
Definition tr|Q2GCS6|Q2GCS6_NEOSM Riboflavin synthase, alpha subunit OS=Neorickettsia sennetsu (strain Miyayama)
Align length 35
Score (bit) 33.5
E-value 5.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916132|Adiantum capillus-veneris mRNA, clone:
YMU001_000083_E06.
(184 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q2GCS6|Q2GCS6_NEOSM Riboflavin synthase, alpha subunit OS=Neo... 33 5.5

>tr|Q2GCS6|Q2GCS6_NEOSM Riboflavin synthase, alpha subunit
OS=Neorickettsia sennetsu (strain Miyayama) GN=ribE-2
PE=4 SV=1
Length = 200

Score = 33.5 bits (75), Expect = 5.5
Identities = 16/35 (45%), Positives = 20/35 (57%)
Frame = -1

Query: 157 SSLACNGTSQAVDCLTNTSLLFLMNQHWLSVTQAH 53
SS+ACNG V +TNT L F ++Q S T H
Sbjct: 39 SSIACNGVCLTVTSITNTELEFYVSQETFSRTNFH 73