BP916138
Clone id YMU001_000083_F01
Library
Length 473
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000083_F01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GAGGTATGGGAGCACACAAGCATCAGCTAATTCTGCGGCTCTGTAAGCGACACTTGCTGC
CATGCATGCAATGCGAAGGCTGAAGAGCTATGCGGCAGGGCGGTCATCGGTATCTGCTGA
GGTTGGAGATGATTCAGGTTGCCCAGTAAGGGAAAGAGTAGCTGACAAGACATTATTGGG
TGATCCGGCTGAGAGTTTGAGGGACCAGTGTACGATGGCCTCTGCCAGAGTTGAGCCAGG
AGTGGCTCGAACAGGAGCAGGGTCCAGCACAGTATTTGCTGGAAAGGGAGGTGTAGATCA
GCTGCCGAGGGAGATGCTTGAGATGAAGCTGCGAGACAATAGGCTGGACGATAGCGGCAA
TGACAAGGAGGGAGCAACGGCTCTTGCTAATAGCAACAGCACGGAGTCTGGCAACATCAT
TGTGACAGCAGTGGCAGGCTCAAATGGGCAACAAAAGCAGGTTATTAGCTATA
■■Homology search results ■■ -
sp_hit_id Q96287
Definition sp|Q96287|KSG8_ARATH Shaggy-related protein kinase theta OS=Arabidopsis thaliana
Align length 135
Score (bit) 72.0
E-value 1.0e-12
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916138|Adiantum capillus-veneris mRNA, clone:
YMU001_000083_F01.
(473 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q96287|KSG8_ARATH Shaggy-related protein kinase theta OS=Arab... 72 1e-12
sp|P43289|KSG3_ARATH Shaggy-related protein kinase gamma OS=Arab... 62 1e-09
sp|P43288|KSG1_ARATH Shaggy-related protein kinase alpha OS=Arab... 62 1e-09
sp|P51139|MSK3_MEDSA Glycogen synthase kinase-3 homolog MsK-3 OS... 61 3e-09
sp|P51138|MSK2_MEDSA Glycogen synthase kinase-3 homolog MsK-2 OS... 60 6e-09
sp|O04160|KSGT_BRANA Shaggy-related protein kinase theta OS=Bras... 60 6e-09
sp|P51137|MSK1_MEDSA Glycogen synthase kinase-3 homolog MsK-1 OS... 59 8e-09
sp|Q40518|MSK1_TOBAC Shaggy-related protein kinase NtK-1 OS=Nico... 59 1e-08
sp|Q8VZD5|KSG5_ARATH Shaggy-related protein kinase epsilon OS=Ar... 53 8e-07
sp|Q9FVS6|KSG4_ARATH Shaggy-related protein kinase delta OS=Arab... 48 2e-05
sp|Q39019|KSG10_ARATH Shaggy-related protein kinase kappa OS=Ara... 44 4e-04
sp|Q39010|KSG6_ARATH Shaggy-related protein kinase zeta OS=Arabi... 43 8e-04
sp|Q39012|KSG9_ARATH Shaggy-related protein kinase iota OS=Arabi... 39 0.009
sp|Q80W04|TMCC2_MOUSE Transmembrane and coiled-coil domains prot... 37 0.034
sp|Q39011|KSG7_ARATH Shaggy-related protein kinase eta OS=Arabid... 37 0.058
sp|O75069|TMCC2_HUMAN Transmembrane and coiled-coil domains prot... 35 0.13
sp|Q0JGZ6|SCRK1_ORYSJ Fructokinase-1 OS=Oryza sativa subsp. japo... 35 0.13
sp|A2WXV8|SCRK1_ORYSI Fructokinase-1 OS=Oryza sativa subsp. indi... 35 0.13
sp|Q6XZ79|SCRK1_MAIZE Fructokinase-1 OS=Zea mays GN=FRK1 PE=1 SV=1 35 0.22
sp|O95081|AGFG2_HUMAN Arf-GAP domain and FG repeats-containing p... 33 0.49
sp|Q7RVQ8|PACC_NEUCR pH-response transcription factor pacC/RIM10... 33 0.64
sp|Q1AXU6|CH60_RUBXD 60 kDa chaperonin OS=Rubrobacter xylanophil... 33 0.64
sp|Q9WV48|SHAN1_RAT SH3 and multiple ankyrin repeat domains prot... 32 1.4
sp|Q8TAX7|MUC7_HUMAN Mucin-7 OS=Homo sapiens GN=MUC7 PE=1 SV=1 32 1.4
sp|A3BUD2|C3H57_ORYSJ Putative zinc finger CCCH domain-containin... 32 1.9
sp|A6LSY8|GSA_CLOB8 Glutamate-1-semialdehyde 2,1-aminomutase OS=... 31 3.2
sp|Q9HWY1|RIBA_PSEAE GTP cyclohydrolase-2 OS=Pseudomonas aerugin... 30 4.2
sp|Q02SL4|RIBA_PSEAB GTP cyclohydrolase-2 OS=Pseudomonas aerugin... 30 4.2
sp|P98158|LRP2_RAT Low-density lipoprotein receptor-related prot... 30 4.2
sp|O23145|KSG2_ARATH Shaggy-related protein kinase beta OS=Arabi... 30 4.2

>sp|Q96287|KSG8_ARATH Shaggy-related protein kinase theta
OS=Arabidopsis thaliana GN=ASK8 PE=2 SV=3
Length = 472

Score = 72.0 bits (175), Expect = 1e-12
Identities = 48/135 (35%), Positives = 70/135 (51%), Gaps = 2/135 (1%)
Frame = +2

Query: 74 RRLKSYAAGRSSVSAEVGDDSGCP-VRERVADKTLLGDPAE-SLRDQCTMASARVEPGVA 247
RRLKS A+GR+S+S++ G D + + L DP + C A V +
Sbjct: 5 RRLKSIASGRTSISSDPGGDYALKRAKLDQENDNLCVDPMQVDQNSSCFEMKADVLSQES 64

Query: 248 RTGAGSSTVFAGKGGVDQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGNIIVT 427
G + + K DQLP M+EMK+RD R + + DK+ T + N + TE+G +I T
Sbjct: 65 VAGTSNVPAVSEKPVDDQLPDVMIEMKIRDER-NANREDKDMETTVVNGSGTETGQVITT 123

Query: 428 AVAGSNGQQKQVISY 472
V G +G+ KQ ISY
Sbjct: 124 TVGGRDGKPKQTISY 138


>sp|P43289|KSG3_ARATH Shaggy-related protein kinase gamma
OS=Arabidopsis thaliana GN=ASK3 PE=2 SV=1
Length = 409

Score = 62.4 bits (150), Expect = 1e-09
Identities = 38/87 (43%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
Frame = +2

Query: 215 MASARVEPGVA-RTGAGSSTVFAGKGGVDQLPREMLEMKLRDNRLDDSGNDKEGATALAN 391
MAS +EP A R G+ T D+LP EM +MK++D DKE + N
Sbjct: 1 MASVGIEPSAAVRESTGNVT------DADRLPEEMKDMKIQD--------DKEMEATIVN 46

Query: 392 SNSTESGNIIVTAVAGSNGQQKQVISY 472
N TE+G+IIVT + G NGQ KQ ISY
Sbjct: 47 GNVTETGHIIVTTIGGRNGQPKQTISY 73


>sp|P43288|KSG1_ARATH Shaggy-related protein kinase alpha
OS=Arabidopsis thaliana GN=ASK1 PE=2 SV=3
Length = 405

Score = 62.4 bits (150), Expect = 1e-09
Identities = 39/86 (45%), Positives = 48/86 (55%)
Frame = +2

Query: 215 MASARVEPGVARTGAGSSTVFAGKGGVDQLPREMLEMKLRDNRLDDSGNDKEGATALANS 394
MAS + P GA ST GVD+LP EM +MK+RD DKE + +
Sbjct: 1 MASVGIAPN---PGARDST------GVDKLPEEMNDMKIRD--------DKEMEATVVDG 43

Query: 395 NSTESGNIIVTAVAGSNGQQKQVISY 472
N TE+G+IIVT + G NGQ KQ ISY
Sbjct: 44 NGTETGHIIVTTIGGRNGQPKQTISY 69


>sp|P51139|MSK3_MEDSA Glycogen synthase kinase-3 homolog MsK-3
OS=Medicago sativa GN=MSK-3 PE=2 SV=2
Length = 411

Score = 60.8 bits (146), Expect = 3e-09
Identities = 37/86 (43%), Positives = 51/86 (59%)
Frame = +2

Query: 215 MASARVEPGVARTGAGSSTVFAGKGGVDQLPREMLEMKLRDNRLDDSGNDKEGATALANS 394
MAS V P +S+V GV++LP EM +MK+RD++ + E AT + +
Sbjct: 1 MASGGVAPASGFIDKNASSV-----GVEKLPEEMNDMKIRDDK------EMEAAT-IVDG 48

Query: 395 NSTESGNIIVTAVAGSNGQQKQVISY 472
N TE+G+IIVT + G NGQ KQ ISY
Sbjct: 49 NGTETGHIIVTTIGGKNGQPKQTISY 74


>sp|P51138|MSK2_MEDSA Glycogen synthase kinase-3 homolog MsK-2
OS=Medicago sativa GN=MSK-2 PE=2 SV=1
Length = 411

Score = 59.7 bits (143), Expect = 6e-09
Identities = 35/86 (40%), Positives = 49/86 (56%)
Frame = +2

Query: 215 MASARVEPGVARTGAGSSTVFAGKGGVDQLPREMLEMKLRDNRLDDSGNDKEGATALANS 394
MA+A V P +S+ A VD+LP E+L M+++D DKE + +
Sbjct: 1 MATAGVAPASGIVDVNASSAIA----VDKLPDEILGMRIKD--------DKEMEAHVVDG 48

Query: 395 NSTESGNIIVTAVAGSNGQQKQVISY 472
NSTE+G++IVT + G NGQ KQ ISY
Sbjct: 49 NSTEAGHVIVTTIGGKNGQPKQTISY 74


>sp|O04160|KSGT_BRANA Shaggy-related protein kinase theta
OS=Brassica napus PE=2 SV=2
Length = 468

Score = 59.7 bits (143), Expect = 6e-09
Identities = 47/138 (34%), Positives = 67/138 (48%), Gaps = 5/138 (3%)
Frame = +2

Query: 74 RRLKSYAAGRSSVSAEVGDDSGCPVRERVADKTLL---GDPAESLRDQCTMASARVEPGV 244
RRLKS A+GR+S+S++ G DS + D L GD + M +
Sbjct: 5 RRLKSIASGRTSISSDPGVDSSLKRPKLDQDNDNLSSRGDDPMQVDQSTDMVVVSQD--- 61

Query: 245 ARTGAGSSTVFAGKGGVDQLPREMLEMKLRDNR--LDDSGNDKEGATALANSNSTESGNI 418
T AG+S V DQLP M +M+LR++ + DK+ + N TE+G +
Sbjct: 62 --TVAGTSNV---PPPPDQLPEVMNDMRLREDEPHANRGEEDKDMEPPIVNGCGTETGQV 116

Query: 419 IVTAVAGSNGQQKQVISY 472
I T V G +G+ KQ ISY
Sbjct: 117 ITTTVGGRDGKPKQTISY 134


>sp|P51137|MSK1_MEDSA Glycogen synthase kinase-3 homolog MsK-1
OS=Medicago sativa GN=MSK-1 PE=2 SV=1
Length = 411

Score = 59.3 bits (142), Expect = 8e-09
Identities = 35/79 (44%), Positives = 45/79 (56%), Gaps = 1/79 (1%)
Frame = +2

Query: 239 GVARTGAGSSTVFAGKGGVDQ-LPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGN 415
GVA T + G+ GVD LP EM +MK+RD D+E + + N TE+G+
Sbjct: 5 GVAPTSGFREVLGDGEIGVDDILPEEMSDMKIRD--------DREMEATVVDGNGTETGH 56

Query: 416 IIVTAVAGSNGQQKQVISY 472
IIVT + G NGQ KQ ISY
Sbjct: 57 IIVTTIGGRNGQPKQTISY 75


>sp|Q40518|MSK1_TOBAC Shaggy-related protein kinase NtK-1
OS=Nicotiana tabacum GN=NTK-1 PE=2 SV=1
Length = 409

Score = 58.9 bits (141), Expect = 1e-08
Identities = 30/61 (49%), Positives = 40/61 (65%)
Frame = +2

Query: 290 GVDQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGNIIVTAVAGSNGQQKQVIS 469
GVD+LP EM +M++RD DKE A+ + N TE+G+IIVT + G +GQ KQ IS
Sbjct: 21 GVDRLPEEMNDMRIRD--------DKEIEAAIVDGNGTETGHIIVTTIGGRHGQPKQTIS 72

Query: 470 Y 472
Y
Sbjct: 73 Y 73


>sp|Q8VZD5|KSG5_ARATH Shaggy-related protein kinase epsilon
OS=Arabidopsis thaliana GN=ASK5 PE=2 SV=1
Length = 410

Score = 52.8 bits (125), Expect = 8e-07
Identities = 27/59 (45%), Positives = 37/59 (62%)
Frame = +2

Query: 296 DQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGNIIVTAVAGSNGQQKQVISY 472
++LP + EMK++D DKE A+ + N TE+G+IIVT + G NGQ KQ ISY
Sbjct: 24 EKLPEGINEMKIKD--------DKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISY 74


>sp|Q9FVS6|KSG4_ARATH Shaggy-related protein kinase delta
OS=Arabidopsis thaliana GN=ASK4 PE=2 SV=1
Length = 420

Score = 48.1 bits (113), Expect = 2e-05
Identities = 25/60 (41%), Positives = 34/60 (56%)
Frame = +2

Query: 293 VDQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGNIIVTAVAGSNGQQKQVISY 472
VD L R+MLEMK+RD D D E + + E G++I T + G NGQ +Q +SY
Sbjct: 25 VDWLSRDMLEMKIRDKTEADEERDSE--PDIIDGVGAEPGHVITTTLPGRNGQSRQTVSY 82


tr_hit_id A7PXZ0
Definition tr|A7PXZ0|A7PXZ0_VITVI Chromosome chr15 scaffold_37, whole genome shotgun sequence OS=Vitis vinifera
Align length 139
Score (bit) 85.9
E-value 9.0e-16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916138|Adiantum capillus-veneris mRNA, clone:
YMU001_000083_F01.
(473 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PXZ0|A7PXZ0_VITVI Chromosome chr15 scaffold_37, whole genom... 86 9e-16
tr|O82029|O82029_TOBAC Shaggy-like kinase 91 OS=Nicotiana tabacu... 85 2e-15
tr|O24139|O24139_TOBAC Shaggy-like kinase 6 (Nsk6) OS=Nicotiana ... 84 5e-15
tr|Q9FSG4|Q9FSG4_MEDSA Wound-induced GSK-3-like protein (Fragmen... 83 6e-15
tr|O24130|O24130_TOBAC Shaggy-like kinase 59 OS=Nicotiana tabacu... 83 8e-15
tr|O82038|O82038_PETHY Shaggy kinase 6 OS=Petunia hybrida GN=PSK... 82 2e-14
tr|Q5EZ69|Q5EZ69_SOLPE Shaggy-related protein kinase 6 OS=Solanu... 80 5e-14
tr|Q53VM1|Q53VM1_LOTJA Ser/Thr protein kinase OS=Lotus japonicus... 79 1e-13
tr|Q8LNI5|Q8LNI5_ORYSJ Os10g0521700 protein OS=Oryza sativa subs... 77 4e-13
tr|B8BHX5|B8BHX5_ORYSI Putative uncharacterized protein OS=Oryza... 77 4e-13
tr|A3C6K4|A3C6K4_ORYSJ Putative uncharacterized protein OS=Oryza... 77 4e-13
tr|Q6VM08|Q6VM08_PHYPA Shaggy-related protein kinase 2 OS=Physco... 76 7e-13
tr|A9SAB0|A9SAB0_PHYPA Predicted protein OS=Physcomitrella paten... 76 7e-13
tr|O24129|O24129_TOBAC Shaggy-like kinase 111 OS=Nicotiana tabac... 76 1e-12
tr|Q6VM07|Q6VM07_PHYPA Shaggy-related protein kinase 3 OS=Physco... 73 6e-12
tr|A9TSH9|A9TSH9_PHYPA Predicted protein OS=Physcomitrella paten... 73 6e-12
tr|A9S6L2|A9S6L2_PHYPA Predicted protein OS=Physcomitrella paten... 73 6e-12
tr|Q6VM11|Q6VM11_PHYPA Shaggy-related protein kinase 4 OS=Physco... 72 1e-11
tr|Q0WWY4|Q0WWY4_ARATH Shaggy related protein kinase theta OS=Ar... 72 1e-11
tr|O82707|O82707_PETHY Shaggy kinase 7 OS=Petunia hybrida GN=PSK... 72 1e-11
tr|A9SFW7|A9SFW7_PHYPA Predicted protein OS=Physcomitrella paten... 72 2e-11
tr|Q6VM14|Q6VM14_PHYPA Shaggy-related protein kinase 1 OS=Physco... 71 2e-11
tr|Q6VM09|Q6VM09_PHYPA Shaggy-related protein kinase 1 (Fragment... 71 2e-11
tr|A9TSI8|A9TSI8_PHYPA Predicted protein OS=Physcomitrella paten... 71 2e-11
tr|A9SAB9|A9SAB9_PHYPA Predicted protein OS=Physcomitrella paten... 71 2e-11
tr|B8LN87|B8LN87_PICSI Putative uncharacterized protein OS=Picea... 64 4e-09
tr|A9NUW7|A9NUW7_PICSI Putative uncharacterized protein OS=Picea... 64 4e-09
tr|A6YP74|A6YP74_ORYSJ RIM11-like protein (Fragment) OS=Oryza sa... 64 4e-09
tr|A7PM77|A7PM77_VITVI Chromosome chr14 scaffold_21, whole genom... 64 5e-09
tr|A5C9G3|A5C9G3_VITVI Putative uncharacterized protein (Fragmen... 64 5e-09

>tr|A7PXZ0|A7PXZ0_VITVI Chromosome chr15 scaffold_37, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00026235001
PE=4 SV=1
Length = 468

Score = 85.9 bits (211), Expect = 9e-16
Identities = 57/139 (41%), Positives = 78/139 (56%), Gaps = 6/139 (4%)
Frame = +2

Query: 74 RRLKSYAAGRSSVSAEVGDDSGCPVR------ERVADKTLLGDPAESLRDQCTMASARVE 235
RRLKS A+GRSSVS GD S + ++VAD+T + + SL MAS E
Sbjct: 5 RRLKSIASGRSSVSDPGGDSSTKRAKVDQEAEQKVADETHSVEKSTSLEQH--MASTSQE 62

Query: 236 PGVARTGAGSSTVFAGKGGVDQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGN 415
A T SS + G DQLP+EM +MK+RD ++D +DK+ + + + TE+G
Sbjct: 63 TA-ASTSNVSSIARTEQSGYDQLPKEMHDMKIRDEKVDPH-DDKDAEPTVVSGSGTETGQ 120

Query: 416 IIVTAVAGSNGQQKQVISY 472
II T + G NGQ KQ +SY
Sbjct: 121 IIATTIGGRNGQPKQTVSY 139


>tr|O82029|O82029_TOBAC Shaggy-like kinase 91 OS=Nicotiana tabacum
GN=NSK 91 PE=2 SV=1
Length = 471

Score = 85.1 bits (209), Expect = 2e-15
Identities = 57/140 (40%), Positives = 84/140 (60%), Gaps = 7/140 (5%)
Frame = +2

Query: 74 RRLKSYAAGRSSVSAEVGDDSGCPVR-ERVADKTLLGDPAESLRDQCTMASARVE-PGVA 247
RRLKS A+GRSSVS GD S V+ E+ D+ L+G+ + ++CT + + P +
Sbjct: 5 RRLKSIASGRSSVSDPGGDSSIKRVKVEQEVDQRLVGET--QMEERCTTTFPKEDMPSTS 62

Query: 248 R-TGAGSSTVFAGK---GGVDQLPREMLEMKLRDNRLDD-SGNDKEGATALANSNSTESG 412
+ T GS++ + D+LP+EM EMK++D + D N K+ A+ + N TE+G
Sbjct: 63 KGTTTGSTSTMDTRPENSEFDELPKEMHEMKIKDEKTDSHEDNLKDMEPAVVSGNGTETG 122

Query: 413 NIIVTAVAGSNGQQKQVISY 472
IIVT V+G NGQQKQ +SY
Sbjct: 123 QIIVTTVSGRNGQQKQTLSY 142


>tr|O24139|O24139_TOBAC Shaggy-like kinase 6 (Nsk6) OS=Nicotiana
tabacum PE=2 SV=1
Length = 471

Score = 83.6 bits (205), Expect = 5e-15
Identities = 56/142 (39%), Positives = 82/142 (57%), Gaps = 9/142 (6%)
Frame = +2

Query: 74 RRLKSYAAGRSSVSAEVGDDSGCPVR-ERVADKTLLGDPAESLRDQCTMASARVEPGVAR 250
RRLKS A+GRSSVS GD S V+ E+ D+ ++G+ + ++CT + + +A
Sbjct: 5 RRLKSIASGRSSVSDPGGDSSIKRVKVEQEVDQRVVGET--QMEERCTTIVPKED--MAS 60

Query: 251 TGAGSSTVFAG-------KGGVDQLPREMLEMKLRDNRLDD-SGNDKEGATALANSNSTE 406
T G++T D+LP+EM EMK++D + D N K+ A+ + N TE
Sbjct: 61 TSKGTTTGSTSTMDTRPENSEFDELPKEMHEMKIKDEKADSHEDNLKDMEPAVVSGNGTE 120

Query: 407 SGNIIVTAVAGSNGQQKQVISY 472
+G IIVT V+G NGQQKQ +SY
Sbjct: 121 TGQIIVTTVSGRNGQQKQTLSY 142


>tr|Q9FSG4|Q9FSG4_MEDSA Wound-induced GSK-3-like protein (Fragment)
OS=Medicago sativa GN=wig PE=2 SV=1
Length = 468

Score = 83.2 bits (204), Expect = 6e-15
Identities = 51/137 (37%), Positives = 75/137 (54%), Gaps = 4/137 (2%)
Frame = +2

Query: 74 RRLKSYAAGRSSVSAEVGDDSGCPVRERVADKTLLGDPAESL----RDQCTMASARVEPG 241
RRLKS A+GR+S+S++ G DS + + + + SL R+QC AS G
Sbjct: 5 RRLKSIASGRTSISSDPGGDSNSKRVKLDQETEKVYEGINSLGRNDREQCVDASKEASVG 64

Query: 242 VARTGAGSSTVFAGKGGVDQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGNII 421
+ + T K G D+LP+E+ EMK+RD + + N+K+ + N TE+G II
Sbjct: 65 TSNE-VSTETKTEKKSGFDELPKELHEMKIRDEK-SKNNNEKDIEATTVSGNGTETGQII 122

Query: 422 VTAVAGSNGQQKQVISY 472
T +AG +GQ KQ ISY
Sbjct: 123 TTTIAGRDGQPKQTISY 139


>tr|O24130|O24130_TOBAC Shaggy-like kinase 59 OS=Nicotiana tabacum
GN=NSK 59 PE=2 SV=1
Length = 469

Score = 82.8 bits (203), Expect = 8e-15
Identities = 57/141 (40%), Positives = 83/141 (58%), Gaps = 8/141 (5%)
Frame = +2

Query: 74 RRLKSYAAGRSSVSAEVGDDSGCPVR-ERVADKTLLGDPAESLRDQCTMASARVEPGVAR 250
RRLKS A+GRSSVS GD S V+ E+ D + G+ +QCT+A + V
Sbjct: 5 RRLKSIASGRSSVSDPGGDFSLKRVKVEQEVDHRVDGETQSE--EQCTIAPKQ---DVTS 59

Query: 251 TGAGSSTVFAG------KGGVDQLPREMLEMKLRDNRLDDSGND-KEGATALANSNSTES 409
T + S+T K G ++LP+EM EMK+RD++ + +D K+ A+ + N TE+
Sbjct: 60 TSSESTTTTLNVDTRPEKSGYEELPKEMNEMKIRDDKTNGREDDIKDMEPAVVSGNGTET 119

Query: 410 GNIIVTAVAGSNGQQKQVISY 472
G IIVT ++G NGQQK+ +SY
Sbjct: 120 GQIIVTTLSGRNGQQKKTLSY 140


>tr|O82038|O82038_PETHY Shaggy kinase 6 OS=Petunia hybrida GN=PSK6
PE=4 SV=1
Length = 470

Score = 81.6 bits (200), Expect = 2e-14
Identities = 54/139 (38%), Positives = 78/139 (56%), Gaps = 6/139 (4%)
Frame = +2

Query: 74 RRLKSYAAGRSSVSAEVGDDSGCPVRERVADKTLLGDPAESLRDQCTMASARVEPGVAR- 250
RRLKS +GRSS+S GD S V+ + ++GD + D+CT + + +
Sbjct: 5 RRLKSITSGRSSISDPGGDSSIKRVKVEQEIERVVGDT--QMDDRCTTTAPKEDMASTSK 62

Query: 251 --TGAGSSTVFAG--KGGVDQLPREMLEMKLRDNRLDD-SGNDKEGATALANSNSTESGN 415
T A +ST+ VD+LP+E+ EMK++D R D N K+ A+ + N E+G
Sbjct: 63 DTTTASTSTMDTRPENSEVDELPKELHEMKIKDERTDSHEDNLKDMEPAVVSGNGAETGQ 122

Query: 416 IIVTAVAGSNGQQKQVISY 472
IIVT V+G NGQQKQ +SY
Sbjct: 123 IIVTTVSGRNGQQKQTLSY 141


>tr|Q5EZ69|Q5EZ69_SOLPE Shaggy-related protein kinase 6 OS=Solanum
peruvianum GN=SK6 PE=2 SV=1
Length = 475

Score = 80.1 bits (196), Expect = 5e-14
Identities = 57/146 (39%), Positives = 84/146 (57%), Gaps = 13/146 (8%)
Frame = +2

Query: 74 RRLKSYAAGRSSVSAEVGDDSGCPVR-ERVADKTLLGDPAESLRDQCTMASARVEPGVA- 247
RRLKS A+GRSSVS GD S V+ E+ D+ ++G+ + + CT + E +
Sbjct: 5 RRLKSIASGRSSVSDPGGDSSIKRVKVEKEVDQRVVGET--QMEEGCTTTTVPKEDMAST 62

Query: 248 --RTGAGSSTVFAGK---GGVDQLPREMLEMKLRDNR------LDDSGNDKEGATALANS 394
T AGS++ + +D+LP+EM EMK++ + LDD+ D E A+ +
Sbjct: 63 SKETTAGSTSTMDTRLENSELDELPKEMHEMKIKGEKDDKADSLDDNLKDME--PAVVSG 120

Query: 395 NSTESGNIIVTAVAGSNGQQKQVISY 472
N TE+G IIVT V+G NGQ+KQ +SY
Sbjct: 121 NGTETGQIIVTTVSGRNGQEKQTLSY 146


>tr|Q53VM1|Q53VM1_LOTJA Ser/Thr protein kinase OS=Lotus japonicus
PE=2 SV=1
Length = 467

Score = 78.6 bits (192), Expect = 1e-13
Identities = 51/137 (37%), Positives = 80/137 (58%), Gaps = 4/137 (2%)
Frame = +2

Query: 74 RRLKSYAAGRSSVSAEVGDDSGCPVRERVADKT--LLGDPAESL--RDQCTMASARVEPG 241
RRLKS A+GR+S+S++ G DS R ++ +T + + ++L +DQ A E
Sbjct: 5 RRLKSIASGRTSISSDPGGDSNSK-RAKLDQETEKKVNEETKTLGGKDQEQHVDASKEST 63

Query: 242 VARTGAGSSTVFAGKGGVDQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGNII 421
V T S+ K G D+LP+E+ EMK++D + + N+K+ ++ + N TE+G II
Sbjct: 64 VG-TSDVSTVAKTEKSGFDELPKELHEMKIKDEK-SKNNNEKDIEASIVSGNGTETGQII 121

Query: 422 VTAVAGSNGQQKQVISY 472
TA+ G +GQ KQ ISY
Sbjct: 122 TTAIGGRDGQPKQTISY 138


>tr|Q8LNI5|Q8LNI5_ORYSJ Os10g0521700 protein OS=Oryza sativa subsp.
japonica GN=OSJNBb0028C01.28 PE=4 SV=1
Length = 469

Score = 77.0 bits (188), Expect = 4e-13
Identities = 55/140 (39%), Positives = 74/140 (52%), Gaps = 7/140 (5%)
Frame = +2

Query: 74 RRLKSYAAGRSSVSAEVGDDSGCPVRERVADKTLLGDPA--ESLRDQCTMASARVEPGVA 247
RRLKS A+GRSSVS + G DSG + D+ GD L D M +
Sbjct: 5 RRLKSIASGRSSVS-DPGGDSG--TKRPKFDQDGAGDIVIEPHLTDDKPMRVDQESSSSH 61

Query: 248 RTGAGSSTVFAGKG-----GVDQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESG 412
R S++ G G D LP+EM EM + D+++D NDKE + N+N TE+G
Sbjct: 62 RDAEASTSTSKNPGRTEEAGADILPKEMNEMTISDDKVDGH-NDKESEGVIVNANGTETG 120

Query: 413 NIIVTAVAGSNGQQKQVISY 472
IIVT++ G NG+ KQ +SY
Sbjct: 121 QIIVTSIGGQNGKPKQKVSY 140


>tr|B8BHX5|B8BHX5_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_34360 PE=4 SV=1
Length = 525

Score = 77.0 bits (188), Expect = 4e-13
Identities = 55/140 (39%), Positives = 74/140 (52%), Gaps = 7/140 (5%)
Frame = +2

Query: 74 RRLKSYAAGRSSVSAEVGDDSGCPVRERVADKTLLGDPA--ESLRDQCTMASARVEPGVA 247
RRLKS A+GRSSVS + G DSG + D+ GD L D M +
Sbjct: 5 RRLKSIASGRSSVS-DPGGDSG--TKRPKFDQDGAGDIVIEPHLTDDKPMRVDQESSSSH 61

Query: 248 RTGAGSSTVFAGKG-----GVDQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESG 412
R S++ G G D LP+EM EM + D+++D NDKE + N+N TE+G
Sbjct: 62 RDAEASTSTSKNPGRTEEAGADILPKEMNEMTISDDKVDGH-NDKESEGVIVNANGTETG 120

Query: 413 NIIVTAVAGSNGQQKQVISY 472
IIVT++ G NG+ KQ +SY
Sbjct: 121 QIIVTSIGGQNGKPKQKVSY 140