BP916210
Clone id YMU001_000084_E12
Library
Length 510
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000084_E12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CAAGGGCTTTAAAGAGGTGTATTATTTGGAGGGTGGTATACTGAATTACTTAGAAGAAAT
CCCTGCTAGCGAAAGTTTATGGGAAGGCGAGTGTTTTGTGTTTGACAAAAGAGTTTCCGT
GGAGCATGGATTGAAAGTAGGAACTCACAAGCTGTGCTACGCATGCAAGAAGCCGGTAAA
TGATGAGGATATGCTCTCTCCAGCTTGGGAAGATGGAGTGTCATGCCCTTATTGTATTCA
TGTCAAGTCAGAGAAAGAAAAAGAGAGGGCCAGGGCTCGCCAAAGGCAATATGAACACTG
GGACTTGTGGGAGGACCACACAAGGGTAAGCGACCATGGACCCCCGATGATTCTTTCCAG
GAAACTAGGAATTCAGATTTAACAGAGTTGGTGTAAACTAGCTTGAAAGATCTTGAATGT
GGCTTCTTGGGCCTAATGAGAGCCCCTGAAGTCATCAGCTTGCTGTCTTAGGGAGGCCAC
TTCCTTACCATTCATGTGCTTTGATTCAAA
■■Homology search results ■■ -
sp_hit_id Q2K443
Definition sp|Q2K443|Y3638_RHIEC UPF0176 protein RHE_CH03638 OS=Rhizobium etli (strain CFN 42 / ATCC 51251)
Align length 83
Score (bit) 127.0
E-value 4.0e-29
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916210|Adiantum capillus-veneris mRNA, clone:
YMU001_000084_E12.
(510 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q2K443|Y3638_RHIEC UPF0176 protein RHE_CH03638 OS=Rhizobium e... 127 4e-29
sp|Q1MBM8|Y4166_RHIL3 UPF0176 protein RL4166 OS=Rhizobium legumi... 124 3e-28
sp|Q5FSH9|Y895_GLUOX UPF0176 protein GOX0895 OS=Gluconobacter ox... 120 3e-27
sp|Q92LX6|Y2887_RHIME UPF0176 protein R02887 OS=Rhizobium melilo... 117 2e-26
sp|Q8U7F8|Y4491_AGRT5 UPF0176 protein Atu4491 OS=Agrobacterium t... 117 3e-26
sp|Q1QDQ9|Y411_PSYCK UPF0176 protein Pcryo_0411 OS=Psychrobacter... 116 5e-26
sp|Q4FUR9|Y370_PSYA2 UPF0176 protein Psyc_0370 OS=Psychrobacter ... 116 5e-26
sp|A6UD82|Y2782_SINMW UPF0176 protein Smed_2782 OS=Sinorhizobium... 116 5e-26
sp|Q3M998|Y2825_ANAVT UPF0176 protein Ava_2825 OS=Anabaena varia... 116 7e-26
sp|Q8YZS3|Y384_ANASP UPF0176 protein all0384 OS=Anabaena sp. (st... 115 1e-25
sp|A0KXH1|Y2261_SHESA UPF0176 protein Shewana3_2261 OS=Shewanell... 114 3e-25
sp|Q0HJD3|Y1760_SHESM UPF0176 protein Shewmr4_1760 OS=Shewanella... 114 3e-25
sp|Q1GYV1|Y2319_METFK UPF0176 protein Mfla_2319 OS=Methylobacill... 113 6e-25
sp|Q21X17|Y1961_RHOFD UPF0176 protein Rfer_1961 OS=Rhodoferax fe... 113 6e-25
sp|A9L3N9|Y2481_SHEB9 UPF0176 protein Sbal195_2481 OS=Shewanella... 112 1e-24
sp|A6WNW5|Y2366_SHEB8 UPF0176 protein Shew185_2366 OS=Shewanella... 112 1e-24
sp|A3D558|Y2378_SHEB5 UPF0176 protein Sbal_2378 OS=Shewanella ba... 112 1e-24
sp|Q12ME4|Y2100_SHEDO UPF0176 protein Sden_2100 OS=Shewanella de... 112 1e-24
sp|Q8EES8|Y2290_SHEON UPF0176 protein SO_2290 OS=Shewanella onei... 110 3e-24
sp|Q0HVM5|Y1838_SHESR UPF0176 protein Shewmr7_1838 OS=Shewanella... 110 3e-24
sp|A4Y7B8|Y2130_SHEPC UPF0176 protein Sputcn32_2130 OS=Shewanell... 110 4e-24
sp|A1RJ71|Y1881_SHESW UPF0176 protein Sputw3181_1881 OS=Shewanel... 110 4e-24
sp|Q2SPJ7|Y522_HAHCH UPF0176 protein HCH_00522 OS=Hahella chejue... 110 5e-24
sp|Q98H78|Y2992_RHILO UPF0176 protein mll2992 OS=Rhizobium loti ... 109 9e-24
sp|B0C1U8|Y1075_ACAM1 UPF0176 protein AM1_1075 OS=Acaryochloris ... 109 9e-24
sp|B0U150|Y1846_FRAP2 UPF0176 protein Fphi_1841 OS=Francisella p... 108 2e-23
sp|Q0AP18|Y1677_MARMM UPF0176 protein Mmar10_1677 OS=Maricaulis ... 108 2e-23
sp|Q9KSJ7|Y1259_VIBCH UPF0176 protein VC_1259 OS=Vibrio cholerae... 108 2e-23
sp|Q87FT1|Y5597_VIBPA UPF0176 protein VPA1597 OS=Vibrio parahaem... 107 2e-23
sp|Q5LWN8|Y091_SILPO UPF0176 protein SPO0091 OS=Silicibacter pom... 107 2e-23

>sp|Q2K443|Y3638_RHIEC UPF0176 protein RHE_CH03638 OS=Rhizobium etli
(strain CFN 42 / ATCC 51251) GN=RHE_CH03638 PE=3 SV=2
Length = 309

Score = 127 bits (318), Expect = 4e-29
Identities = 52/83 (62%), Positives = 68/83 (81%)
Frame = +2

Query: 2 KGFKEVYYLEGGILNYLEEIPASESLWEGECFVFDKRVSVEHGLKVGTHKLCYACKKPVN 181
+GF EVY+L+GGIL YLEE+P ESLWEG CFVFD+RVSVEHGLK G H+LC+AC+ P+
Sbjct: 200 EGFDEVYHLKGGILKYLEEVPQEESLWEGACFVFDERVSVEHGLKEGEHRLCHACRNPIT 259

Query: 182 DEDMLSPAWEDGVSCPYCIHVKS 250
E++ SP +E+GVSC +C H ++
Sbjct: 260 SEEITSPLYEEGVSCSHCYHTRT 282


>sp|Q1MBM8|Y4166_RHIL3 UPF0176 protein RL4166 OS=Rhizobium
leguminosarum bv. viciae (strain 3841) GN=RL4166 PE=3
SV=1
Length = 309

Score = 124 bits (311), Expect = 3e-28
Identities = 51/83 (61%), Positives = 67/83 (80%)
Frame = +2

Query: 2 KGFKEVYYLEGGILNYLEEIPASESLWEGECFVFDKRVSVEHGLKVGTHKLCYACKKPVN 181
+GF EVY+L+GGIL YLEE+P ESLW+G CFVFD+RVSVEHGLK G H+LC+AC+ P+
Sbjct: 200 EGFDEVYHLKGGILKYLEEVPQEESLWDGACFVFDERVSVEHGLKEGEHRLCHACRNPIT 259

Query: 182 DEDMLSPAWEDGVSCPYCIHVKS 250
E+ SP +E+GVSC +C H ++
Sbjct: 260 AEETTSPLYEEGVSCSHCYHTRT 282


>sp|Q5FSH9|Y895_GLUOX UPF0176 protein GOX0895 OS=Gluconobacter
oxydans GN=GOX0895 PE=3 SV=1
Length = 313

Score = 120 bits (302), Expect = 3e-27
Identities = 49/78 (62%), Positives = 66/78 (84%)
Frame = +2

Query: 2 KGFKEVYYLEGGILNYLEEIPASESLWEGECFVFDKRVSVEHGLKVGTHKLCYACKKPVN 181
+G EVY+L+GGIL YLE +P ESLWEGECFVFD+RVSV+HGL++GTH +C+AC++P+N
Sbjct: 201 EGVDEVYHLKGGILKYLETVPEEESLWEGECFVFDQRVSVKHGLEIGTHDVCHACRRPLN 260

Query: 182 DEDMLSPAWEDGVSCPYC 235
++D SP + GVSCP+C
Sbjct: 261 EKDKASPLFVQGVSCPHC 278


>sp|Q92LX6|Y2887_RHIME UPF0176 protein R02887 OS=Rhizobium meliloti
GN=R02887 PE=3 SV=1
Length = 315

Score = 117 bits (294), Expect = 2e-26
Identities = 51/78 (65%), Positives = 64/78 (82%)
Frame = +2

Query: 2 KGFKEVYYLEGGILNYLEEIPASESLWEGECFVFDKRVSVEHGLKVGTHKLCYACKKPVN 181
+GF+EVY+L+GGIL YLEEIP ESLWEG CFVFD+RVSV HGL+ G H LC+AC++P+
Sbjct: 206 QGFEEVYHLKGGILKYLEEIPPEESLWEGACFVFDERVSVTHGLQEGEHTLCHACRQPLT 265

Query: 182 DEDMLSPAWEDGVSCPYC 235
ED+ SP E+GVSC +C
Sbjct: 266 PEDLQSPLHEEGVSCIHC 283


>sp|Q8U7F8|Y4491_AGRT5 UPF0176 protein Atu4491 OS=Agrobacterium
tumefaciens (strain C58 / ATCC 33970) GN=Atu4491 PE=3
SV=2
Length = 314

Score = 117 bits (293), Expect = 3e-26
Identities = 51/83 (61%), Positives = 64/83 (77%)
Frame = +2

Query: 2 KGFKEVYYLEGGILNYLEEIPASESLWEGECFVFDKRVSVEHGLKVGTHKLCYACKKPVN 181
+GF EVY+L+GGIL YLEE+P ESLWEG CFVFD+RVSV HGL G H+LC+AC+ P+
Sbjct: 205 QGFDEVYHLKGGILKYLEEVPEEESLWEGACFVFDERVSVVHGLAEGDHQLCHACRNPIT 264

Query: 182 DEDMLSPAWEDGVSCPYCIHVKS 250
+ LSP +E+GVSCP C +S
Sbjct: 265 PDVRLSPKFEEGVSCPSCYDERS 287


>sp|Q1QDQ9|Y411_PSYCK UPF0176 protein Pcryo_0411 OS=Psychrobacter
cryohalolentis (strain K5) GN=Pcryo_0411 PE=3 SV=1
Length = 352

Score = 116 bits (291), Expect = 5e-26
Identities = 48/79 (60%), Positives = 65/79 (82%)
Frame = +2

Query: 2 KGFKEVYYLEGGILNYLEEIPASESLWEGECFVFDKRVSVEHGLKVGTHKLCYACKKPVN 181
+GF+EVY+LEGGIL YLEE+PAS+S+WEG+CFVFD RVSV H L+ G+++ C+AC+ P+
Sbjct: 214 QGFEEVYHLEGGILKYLEEVPASDSMWEGDCFVFDNRVSVNHNLEKGSYEQCFACRMPIT 273

Query: 182 DEDMLSPAWEDGVSCPYCI 238
+M SPA+ G SCP+CI
Sbjct: 274 QAEMQSPAYIKGESCPHCI 292


>sp|Q4FUR9|Y370_PSYA2 UPF0176 protein Psyc_0370 OS=Psychrobacter
arcticus (strain DSM 17307 / 273-4) GN=Psyc_0370 PE=3
SV=1
Length = 352

Score = 116 bits (291), Expect = 5e-26
Identities = 48/79 (60%), Positives = 65/79 (82%)
Frame = +2

Query: 2 KGFKEVYYLEGGILNYLEEIPASESLWEGECFVFDKRVSVEHGLKVGTHKLCYACKKPVN 181
+GF+EVY+LEGGIL YLEE+PAS+S+WEG+CFVFD RVSV H L+ G+++ C+AC+ P+
Sbjct: 214 QGFEEVYHLEGGILKYLEEVPASDSMWEGDCFVFDNRVSVNHNLEKGSYEQCFACRMPIT 273

Query: 182 DEDMLSPAWEDGVSCPYCI 238
+M SPA+ G SCP+CI
Sbjct: 274 QAEMQSPAYIKGESCPHCI 292


>sp|A6UD82|Y2782_SINMW UPF0176 protein Smed_2782 OS=Sinorhizobium
medicae (strain WSM419) GN=Smed_2782 PE=3 SV=1
Length = 315

Score = 116 bits (291), Expect = 5e-26
Identities = 51/78 (65%), Positives = 63/78 (80%)
Frame = +2

Query: 2 KGFKEVYYLEGGILNYLEEIPASESLWEGECFVFDKRVSVEHGLKVGTHKLCYACKKPVN 181
+GF+EVY+L+GGIL YLEEIP ESLWEG CFVFD+RVSV HGL+ G H LC+AC++P+
Sbjct: 206 QGFEEVYHLKGGILKYLEEIPPEESLWEGACFVFDERVSVTHGLQEGEHTLCHACRQPLT 265

Query: 182 DEDMLSPAWEDGVSCPYC 235
ED+ SP E+GVSC C
Sbjct: 266 TEDLRSPLHEEGVSCVNC 283


>sp|Q3M998|Y2825_ANAVT UPF0176 protein Ava_2825 OS=Anabaena
variabilis (strain ATCC 29413 / PCC 7937) GN=Ava_2825
PE=3 SV=1
Length = 305

Score = 116 bits (290), Expect = 7e-26
Identities = 47/78 (60%), Positives = 64/78 (82%)
Frame = +2

Query: 2 KGFKEVYYLEGGILNYLEEIPASESLWEGECFVFDKRVSVEHGLKVGTHKLCYACKKPVN 181
+GF EVY+L+GGIL YLE+IP ESLW+GECFVFD+R++V HGL+ GTH+LC+ C P+
Sbjct: 196 QGFAEVYHLKGGILKYLEQIPPEESLWQGECFVFDERIAVVHGLEPGTHELCFCCGHPLA 255

Query: 182 DEDMLSPAWEDGVSCPYC 235
+ED SP +E+G+SC +C
Sbjct: 256 EEDKASPQYEEGISCSHC 273


>sp|Q8YZS3|Y384_ANASP UPF0176 protein all0384 OS=Anabaena sp.
(strain PCC 7120) GN=all0384 PE=3 SV=1
Length = 309

Score = 115 bits (288), Expect = 1e-25
Identities = 47/78 (60%), Positives = 64/78 (82%)
Frame = +2

Query: 2 KGFKEVYYLEGGILNYLEEIPASESLWEGECFVFDKRVSVEHGLKVGTHKLCYACKKPVN 181
+GF EVY+L+GGIL YLE+IP ESLW+GECFVFD+R++V HGL+ GTH+LC+ C P+
Sbjct: 196 QGFAEVYHLKGGILKYLEQIPPEESLWQGECFVFDERIAVVHGLEPGTHELCFCCGHPLA 255

Query: 182 DEDMLSPAWEDGVSCPYC 235
+ED S +E+G+SCP+C
Sbjct: 256 EEDKASLQYEEGISCPHC 273


tr_hit_id Q0DJ66
Definition tr|Q0DJ66|Q0DJ66_ORYSJ Os05g0323100 protein OS=Oryza sativa subsp. japonica
Align length 83
Score (bit) 152.0
E-value 5.0e-38
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916210|Adiantum capillus-veneris mRNA, clone:
YMU001_000084_E12.
(510 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q0DJ66|Q0DJ66_ORYSJ Os05g0323100 protein OS=Oryza sativa subs... 152 5e-38
tr|A2Y381|A2Y381_ORYSI Putative uncharacterized protein OS=Oryza... 152 5e-38
tr|A5B7T5|A5B7T5_VITVI Putative uncharacterized protein OS=Vitis... 143 5e-37
tr|A7Q3Y4|A7Q3Y4_VITVI Chromosome chr13 scaffold_48, whole genom... 143 7e-37
tr|Q1JPN0|Q1JPN0_ARATH At2g40760 OS=Arabidopsis thaliana PE=2 SV=1 140 3e-36
tr|Q56W89|Q56W89_ARATH Rhodanese like protein OS=Arabidopsis tha... 140 4e-36
tr|Q7XJN9|Q7XJN9_ARATH At2g40760 protein OS=Arabidopsis thaliana... 133 2e-34
tr|A9RLA8|A9RLA8_PHYPA Predicted protein (Fragment) OS=Physcomit... 144 2e-33
tr|A9TRF9|A9TRF9_PHYPA Predicted protein OS=Physcomitrella paten... 139 2e-32
tr|B0IUM1|B0IUM1_RHILT Rhodanese domain protein OS=Rhizobium leg... 127 2e-28
tr|B3Q0Q5|B3Q0Q5_RHIE6 Probable rhodanese-related sulfurtransfer... 125 9e-28
tr|B1XN07|B1XN07_SYNP2 Rhodanese-like sulfurtransferase OS=Synec... 124 2e-27
tr|B5ZQU6|B5ZQU6_RHILW Rhodanese domain protein OS=Rhizobium leg... 121 2e-26
tr|B2IVX7|B2IVX7_NOSP7 Rhodanese domain protein OS=Nostoc puncti... 120 5e-26
tr|A3SL04|A3SL04_9RHOB Rhodanese-like domain protein OS=Roseovar... 116 5e-25
tr|Q2N974|Q2N974_ERYLH Putative uncharacterized protein OS=Eryth... 115 9e-25
tr|A0ZKB8|A0ZKB8_NODSP Putative uncharacterized protein OS=Nodul... 115 1e-24
tr|A5VCI9|A5VCI9_SPHWW Rhodanese domain protein OS=Sphingomonas ... 114 4e-24
tr|A4XEB7|A4XEB7_NOVAD Rhodanese domain protein OS=Novosphingobi... 113 5e-24
tr|B4WPJ1|B4WPJ1_9SYNE Rhodanese-like domain protein OS=Synechoc... 113 5e-24
tr|A6DV93|A6DV93_9RHOB Rhodanese-like domain protein OS=Roseovar... 113 5e-24
tr|A6GTP6|A6GTP6_9BURK Putative uncharacterized protein OS=Limno... 113 6e-24
tr|B6BTM3|B6BTM3_9PROT Rhodanese sulfurtransferase OS=beta prote... 112 8e-24
tr|A3W0F3|A3W0F3_9RHOB Rhodanese-like domain protein OS=Roseovar... 112 8e-24
tr|B8K4A2|B8K4A2_VIBPA Putative uncharacterized protein OS=Vibri... 112 1e-23
tr|B1X1A1|B1X1A1_CYAA5 Putative uncharacterized protein OS=Cyano... 112 1e-23
tr|Q1Z0U6|Q1Z0U6_PHOPR Putative uncharacterized protein OS=Photo... 112 1e-23
tr|B8E9F2|B8E9F2_9GAMM Rhodanese domain protein OS=Shewanella ba... 112 1e-23
tr|B6BPD7|B6BPD7_9RICK Rhodanese domain protein OS=Candidatus Pe... 111 2e-23
tr|A9D1W9|A9D1W9_9RHIZ Putative uncharacterized protein OS=Hoefl... 111 2e-23

>tr|Q0DJ66|Q0DJ66_ORYSJ Os05g0323100 protein OS=Oryza sativa subsp.
japonica GN=Os05g0323100 PE=4 SV=1
Length = 462

Score = 152 bits (384), Expect(2) = 5e-38
Identities = 69/83 (83%), Positives = 72/83 (86%)
Frame = +2

Query: 2 KGFKEVYYLEGGILNYLEEIPASESLWEGECFVFDKRVSVEHGLKVGTHKLCYACKKPVN 181
KGFKEVY+LEGGIL YLEEIP +ESLWEGECFVFDKRVSVEHGL GTHKLCY CKKPV+
Sbjct: 332 KGFKEVYHLEGGILKYLEEIPKAESLWEGECFVFDKRVSVEHGLAQGTHKLCYGCKKPVS 391

Query: 182 DEDMLSPAWEDGVSCPYCIHVKS 250
DEDM SP WE GVSCPYC KS
Sbjct: 392 DEDMESPEWEYGVSCPYCFATKS 414



Score = 28.9 bits (63), Expect(2) = 5e-38
Identities = 11/37 (29%), Positives = 19/37 (51%)
Frame = +1

Query: 226 PLLYSCQVRERKREGQGSPKAI*TLGLVGGPHKGKRP 336
P ++ + E K + + T G++GGP KG+ P
Sbjct: 407 PYCFATKSEEEKERARARQRQFETWGVIGGPDKGRSP 443


>tr|A2Y381|A2Y381_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_19469 PE=4 SV=1
Length = 462

Score = 152 bits (384), Expect(2) = 5e-38
Identities = 69/83 (83%), Positives = 72/83 (86%)
Frame = +2

Query: 2 KGFKEVYYLEGGILNYLEEIPASESLWEGECFVFDKRVSVEHGLKVGTHKLCYACKKPVN 181
KGFKEVY+LEGGIL YLEEIP +ESLWEGECFVFDKRVSVEHGL GTHKLCY CKKPV+
Sbjct: 332 KGFKEVYHLEGGILKYLEEIPKAESLWEGECFVFDKRVSVEHGLAQGTHKLCYGCKKPVS 391

Query: 182 DEDMLSPAWEDGVSCPYCIHVKS 250
DEDM SP WE GVSCPYC KS
Sbjct: 392 DEDMESPEWEYGVSCPYCFATKS 414



Score = 28.9 bits (63), Expect(2) = 5e-38
Identities = 11/37 (29%), Positives = 19/37 (51%)
Frame = +1

Query: 226 PLLYSCQVRERKREGQGSPKAI*TLGLVGGPHKGKRP 336
P ++ + E K + + T G++GGP KG+ P
Sbjct: 407 PYCFATKSEEEKERARARQRQFETWGVIGGPDKGRSP 443


>tr|A5B7T5|A5B7T5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_013130 PE=4 SV=1
Length = 500

Score = 143 bits (360), Expect(2) = 5e-37
Identities = 64/83 (77%), Positives = 70/83 (84%)
Frame = +2

Query: 2 KGFKEVYYLEGGILNYLEEIPASESLWEGECFVFDKRVSVEHGLKVGTHKLCYACKKPVN 181
KGFKEVY+LEGGIL YLEE+P +ESLWEGECFVFDKRVSV+HGL GT KLCY CKKPV+
Sbjct: 371 KGFKEVYHLEGGILKYLEEVPETESLWEGECFVFDKRVSVDHGLAQGTFKLCYGCKKPVS 430

Query: 182 DEDMLSPAWEDGVSCPYCIHVKS 250
D DM +P WE GVSCPYC KS
Sbjct: 431 DADMEAPEWEYGVSCPYCYSSKS 453



Score = 34.7 bits (78), Expect(2) = 5e-37
Identities = 15/49 (30%), Positives = 22/49 (44%)
Frame = +1

Query: 226 PLLYSCQVRERKREGQGSPKAI*TLGLVGGPHKGKRPWTPDDSFQETRN 372
P YS + E K + + T G++GGP KG+ P D + N
Sbjct: 446 PYCYSSKSNEEKERARARQRQFETWGIIGGPDKGRXPTVKKDDSERCEN 494


>tr|A7Q3Y4|A7Q3Y4_VITVI Chromosome chr13 scaffold_48, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00029467001
PE=4 SV=1
Length = 416

Score = 143 bits (360), Expect(2) = 7e-37
Identities = 64/83 (77%), Positives = 70/83 (84%)
Frame = +2

Query: 2 KGFKEVYYLEGGILNYLEEIPASESLWEGECFVFDKRVSVEHGLKVGTHKLCYACKKPVN 181
KGFKEVY+LEGGIL YLEE+P +ESLWEGECFVFDKRVSV+HGL GT KLCY CKKPV+
Sbjct: 287 KGFKEVYHLEGGILKYLEEVPETESLWEGECFVFDKRVSVDHGLAQGTFKLCYGCKKPVS 346

Query: 182 DEDMLSPAWEDGVSCPYCIHVKS 250
D DM +P WE GVSCPYC KS
Sbjct: 347 DADMEAPEWEYGVSCPYCYSSKS 369



Score = 34.3 bits (77), Expect(2) = 7e-37
Identities = 15/49 (30%), Positives = 22/49 (44%)
Frame = +1

Query: 226 PLLYSCQVRERKREGQGSPKAI*TLGLVGGPHKGKRPWTPDDSFQETRN 372
P YS + E K + + T G++GGP KG+ P D + N
Sbjct: 362 PYCYSSKSNEEKERARARQRQFETWGIIGGPDKGRGPTVKKDDSERCEN 410


>tr|Q1JPN0|Q1JPN0_ARATH At2g40760 OS=Arabidopsis thaliana PE=2 SV=1
Length = 474

Score = 140 bits (352), Expect(2) = 3e-36
Identities = 61/83 (73%), Positives = 72/83 (86%)
Frame = +2

Query: 2 KGFKEVYYLEGGILNYLEEIPASESLWEGECFVFDKRVSVEHGLKVGTHKLCYACKKPVN 181
+GF+EVY+L+GGIL YLEE+P +ESLWEGECFVFDKRVSVEHGL GTHKLCY CK+P++
Sbjct: 344 QGFEEVYHLKGGILKYLEEVPKTESLWEGECFVFDKRVSVEHGLAQGTHKLCYGCKQPIS 403

Query: 182 DEDMLSPAWEDGVSCPYCIHVKS 250
DEDM +P +E GVSCPYC KS
Sbjct: 404 DEDMEAPEYEYGVSCPYCYSKKS 426



Score = 35.0 bits (79), Expect(2) = 3e-36
Identities = 18/52 (34%), Positives = 26/52 (50%)
Frame = +1

Query: 226 PLLYSCQVRERKREGQGSPKAI*TLGLVGGPHKGKRPWTPDDSFQETRNSDL 381
P YS + E K + G++GGP KG+RP T DS ++ N+ L
Sbjct: 419 PYCYSKKSEEEKERARARQTQFEEWGVIGGPDKGRRPATKPDSPRKKINAKL 470


>tr|Q56W89|Q56W89_ARATH Rhodanese like protein OS=Arabidopsis
thaliana GN=At2g40755 PE=2 SV=1
Length = 457

Score = 140 bits (352), Expect(2) = 4e-36
Identities = 61/83 (73%), Positives = 72/83 (86%)
Frame = +2

Query: 2 KGFKEVYYLEGGILNYLEEIPASESLWEGECFVFDKRVSVEHGLKVGTHKLCYACKKPVN 181
+GF+EVY+L+GGIL YLEE+P +ESLWEGECFVFDKRVSVEHGL GTHKLCY CK+P++
Sbjct: 327 QGFEEVYHLKGGILKYLEEVPKTESLWEGECFVFDKRVSVEHGLAQGTHKLCYGCKQPIS 386

Query: 182 DEDMLSPAWEDGVSCPYCIHVKS 250
DEDM +P +E GVSCPYC KS
Sbjct: 387 DEDMEAPEYEYGVSCPYCYSKKS 409



Score = 35.0 bits (79), Expect(2) = 4e-36
Identities = 18/52 (34%), Positives = 26/52 (50%)
Frame = +1

Query: 226 PLLYSCQVRERKREGQGSPKAI*TLGLVGGPHKGKRPWTPDDSFQETRNSDL 381
P YS + E K + G++GGP KG+RP T DS ++ N+ L
Sbjct: 402 PYCYSKKSEEEKERARARQTQFEEWGVIGGPDKGRRPATKPDSPRKKINAKL 453


>tr|Q7XJN9|Q7XJN9_ARATH At2g40760 protein OS=Arabidopsis thaliana
GN=At2g40760 PE=2 SV=1
Length = 522

Score = 133 bits (335), Expect(2) = 2e-34
Identities = 58/79 (73%), Positives = 68/79 (86%)
Frame = +2

Query: 14 EVYYLEGGILNYLEEIPASESLWEGECFVFDKRVSVEHGLKVGTHKLCYACKKPVNDEDM 193
+VY+L+GGIL YLEE+P +ESLWEGECFVFDKRVSVEHGL GTHKLCY CK+P++DEDM
Sbjct: 321 QVYHLKGGILKYLEEVPKTESLWEGECFVFDKRVSVEHGLAQGTHKLCYGCKQPISDEDM 380

Query: 194 LSPAWEDGVSCPYCIHVKS 250
+P +E GVSCPYC KS
Sbjct: 381 EAPEYEYGVSCPYCYSKKS 399



Score = 35.8 bits (81), Expect(2) = 2e-34
Identities = 19/55 (34%), Positives = 27/55 (49%)
Frame = +1

Query: 226 PLLYSCQVRERKREGQGSPKAI*TLGLVGGPHKGKRPWTPDDSFQETRNSDLTEL 390
P YS + E K + G++GGP KG+RP T DS ++ N+ L L
Sbjct: 392 PYCYSKKSEEEKERARARQTQFEEWGVIGGPDKGRRPATKPDSPRKKINAKLGSL 446


>tr|A9RLA8|A9RLA8_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_23028 PE=4 SV=1
Length = 356

Score = 144 bits (363), Expect = 2e-33
Identities = 65/100 (65%), Positives = 74/100 (74%)
Frame = +2

Query: 2 KGFKEVYYLEGGILNYLEEIPASESLWEGECFVFDKRVSVEHGLKVGTHKLCYACKKPVN 181
+GF EVY LEGGIL YLEEIPASESLW+GECFVFDKRV+V HGLK G+++LCY+CKKPVN
Sbjct: 246 QGFDEVYQLEGGILKYLEEIPASESLWKGECFVFDKRVAVGHGLKQGSYRLCYSCKKPVN 305

Query: 182 DEDMLSPAWEDGVSCPYCIHVKSXXXXXXXXXXXXXXXHW 301
DM SP WE+GV+CPYC H KS HW
Sbjct: 306 SVDMESPLWEEGVTCPYCYHHKSEADKSKARNRHQQFLHW 345


>tr|A9TRF9|A9TRF9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_149438 PE=4 SV=1
Length = 400

Score = 139 bits (349), Expect(2) = 2e-32
Identities = 63/99 (63%), Positives = 70/99 (70%)
Frame = +2

Query: 5 GFKEVYYLEGGILNYLEEIPASESLWEGECFVFDKRVSVEHGLKVGTHKLCYACKKPVND 184
GF EVY+LEGGIL YLEE P SESLWEG+CFVFDKRV+V H LK GT++LCYACK+PVN
Sbjct: 280 GFDEVYHLEGGILKYLEETPPSESLWEGDCFVFDKRVAVGHALKQGTYRLCYACKEPVNS 339

Query: 185 EDMLSPAWEDGVSCPYCIHVKSXXXXXXXXXXXXXXXHW 301
DM SP WE+GVSCPYC KS HW
Sbjct: 340 TDMESPLWEEGVSCPYCYFKKSEAERARARARHEQFLHW 378



Score = 23.9 bits (50), Expect(2) = 2e-32
Identities = 7/12 (58%), Positives = 11/12 (91%)
Frame = +1

Query: 301 GLVGGPHKGKRP 336
G++GGP KG++P
Sbjct: 379 GVIGGPDKGRKP 390


>tr|B0IUM1|B0IUM1_RHILT Rhodanese domain protein OS=Rhizobium
leguminosarum bv. trifolii WSM1325 GN=RlegDRAFT_7437
PE=4 SV=1
Length = 309

Score = 127 bits (320), Expect = 2e-28
Identities = 52/83 (62%), Positives = 69/83 (83%)
Frame = +2

Query: 2 KGFKEVYYLEGGILNYLEEIPASESLWEGECFVFDKRVSVEHGLKVGTHKLCYACKKPVN 181
+GF EVY+L+GGIL YLEE+P ESLW+G CFVFD+RVSVEHGLK G H+LC+AC+ P+
Sbjct: 200 EGFDEVYHLKGGILKYLEEVPQEESLWDGACFVFDERVSVEHGLKQGEHRLCHACRNPIT 259

Query: 182 DEDMLSPAWEDGVSCPYCIHVKS 250
E+M+SP +E+GVSC +C H ++
Sbjct: 260 AEEMISPLYEEGVSCSHCYHTRT 282