BP916213
Clone id YMU001_000084_F03
Library
Length 543
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000084_F03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATCTTTTGTACAACAGCGGCTTTTGTGCCTAGAGAATCTTCTACCAGATTTTGATGTTTT
TCTGCCAGACTGGCAAAAACCCGCTCATACATGTACATGTACAGAGGACCCTATTCCTCG
CCTTTCAAAACTGGGACCTTTCTTAGAGCCTGCGCAAGTCAAAATGGGCAAATGGATGTC
GCCTTTAAATATTCTGCACACATTGAACCTGTTCCTGGTTTTATAAATTATATGCTCCAC
CTCTAGTGCAGAAGAGTTCGCGAAAGAGCTCTTTATTCATTTCATTGCTTTTGCTACCCA
AACATATGTTCCTCTTGAGTGCAGATCTTATGCATTTCATTGATTTGGCTACCTCAAGTC
ATACTCTACTCTCAATTGGGTGTTGATGTATGATAGTAGCCTTGATAACCAAACACTGAA
GAAGCTTCCTAAGAGGTTGCCTCTTATCTATTGTGAGCCTTGCATCTTTTTTCTCAGTGT
CTTGAAGCCTTCTTTATAATTGCCTCATGTGCAATGCCAGGTCCTCCCTAGTCATTTCAT
CAT
■■Homology search results ■■ -
sp_hit_id P43583
Definition sp|P43583|BLM10_YEAST Proteasome activator BLM10 OS=Saccharomyces cerevisiae
Align length 58
Score (bit) 30.8
E-value 4.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916213|Adiantum capillus-veneris mRNA, clone:
YMU001_000084_F03.
(543 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P43583|BLM10_YEAST Proteasome activator BLM10 OS=Saccharomyce... 31 4.5

>sp|P43583|BLM10_YEAST Proteasome activator BLM10 OS=Saccharomyces
cerevisiae GN=BLM10 PE=1 SV=2
Length = 2143

Score = 30.8 bits (68), Expect = 4.5
Identities = 19/58 (32%), Positives = 27/58 (46%)
Frame = +2

Query: 230 ICSTSSAEEFAKELFIHFIAFATQTYVPLECRSYAFH*FGYLKSYSTLNWVLMYDSSL 403
IC TS E E+F++ I+ +Q P + +Y F YL N L+YD L
Sbjct: 564 ICLTSFCHEEIVEIFLNIISLGSQNKNP-DIANYYISCFAYLLELDPSNAYLIYDKIL 620


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916213|Adiantum capillus-veneris mRNA, clone:
YMU001_000084_F03.
(543 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******