BP916217
Clone id YMU001_000084_F07
Library
Length 479
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000084_F07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AGCAGGTGTGATGCCAGTTATGATCATGCCCTGCAGCTTTCTAAACAAGAAGATGTCTTG
AACAAGGAGAGCTCTACTCAAAATGCACAAGGTTGCAATGCGTTTGACGACTCTTTGAGT
ACACGTATTGCCCATCAGAGTGAGGCTCACAATACTGATATATTGGACTTCCATCATCAA
GAAACTGCGGACCTTGAGTTTCTGATGTCAGAAGATGTGGACGATTCAAGCCAGGAGCCA
TGCATTGACAGTTGGCGCACTGTGACATCATCCAGCTTGTCTGAATTGTCTGCTGAGCAG
GTTGAGGGGTATATAGCTTCATTGAGAGGTATTGTCAATGAGGATGAAGAGACAGGTGTT
TTGCCCACCCATGTGGTGACAGAGGTTGTGGCTGATTCGAATGTCCCGGACAATAATCTG
GAAACTGAATCTGGGCCTAAGGGGAGTCAAGGAGTCGGTGCTTGCAAGACTATCGCACC
■■Homology search results ■■ -
sp_hit_id Q571K4
Definition sp|Q571K4|TAB3_MOUSE Mitogen-activated protein kinase kinase kinase 7-interacting protein 3 OS=Mus musculus
Align length 119
Score (bit) 35.0
E-value 0.16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916217|Adiantum capillus-veneris mRNA, clone:
YMU001_000084_F07.
(465 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q571K4|TAB3_MOUSE Mitogen-activated protein kinase kinase kin... 35 0.16
sp|Q3MIF2|LMBL2_RAT Lethal(3)malignant brain tumor-like 2 protei... 32 1.1
sp|Q54EQ9|Y1586_DICDI Putative uncharacterized protein DDB_G0291... 32 1.8
sp|P42835|EGT2_YEAST Protein EGT2 OS=Saccharomyces cerevisiae GN... 32 1.8
sp|P66716|RPOE_STAAW Probable DNA-directed RNA polymerase subuni... 32 1.8
sp|A8YY93|RPOE_STAAT Probable DNA-directed RNA polymerase subuni... 32 1.8
sp|Q6G7I2|RPOE_STAAS Probable DNA-directed RNA polymerase subuni... 32 1.8
sp|Q6GEU7|RPOE_STAAR Probable DNA-directed RNA polymerase subuni... 32 1.8
sp|P66715|RPOE_STAAN Probable DNA-directed RNA polymerase subuni... 32 1.8
sp|P66714|RPOE_STAAM Probable DNA-directed RNA polymerase subuni... 32 1.8
sp|A6QIX2|RPOE_STAAE Probable DNA-directed RNA polymerase subuni... 32 1.8
sp|Q5HE72|RPOE_STAAC Probable DNA-directed RNA polymerase subuni... 32 1.8
sp|A5IUS3|RPOE_STAA9 Probable DNA-directed RNA polymerase subuni... 32 1.8
sp|Q2FWD0|RPOE_STAA8 Probable DNA-directed RNA polymerase subuni... 32 1.8
sp|Q2FF00|RPOE_STAA3 Probable DNA-directed RNA polymerase subuni... 32 1.8
sp|A6U3L3|RPOE_STAA2 Probable DNA-directed RNA polymerase subuni... 32 1.8
sp|A7X4Y0|RPOE_STAA1 Probable DNA-directed RNA polymerase subuni... 32 1.8
sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster G... 32 1.8
sp|Q2YUM5|RPOE_STAAB Probable DNA-directed RNA polymerase subuni... 31 2.3
sp|Q5R737|LMBL2_PONAB Lethal(3)malignant brain tumor-like 2 prot... 31 2.3
sp|Q969R5|LMBL2_HUMAN Lethal(3)malignant brain tumor-like 2 prot... 31 2.3
sp|P33234|ADIY_ECOLI HTH-type transcriptional regulator adiY OS=... 31 3.0
sp|Q7YRZ8|MDM2_FELCA E3 ubiquitin-protein ligase Mdm2 OS=Felis s... 31 3.1
sp|P59178|LMBL2_MOUSE Lethal(3)malignant brain tumor-like 2 prot... 31 3.1
sp|Q04829|DLDH_HALVO Dihydrolipoyl dehydrogenase OS=Halobacteriu... 30 4.0
sp|Q75BI6|MED15_ASHGO Mediator of RNA polymerase II transcriptio... 30 5.1
sp|Q59KI4|INO80_CANAL Putative DNA helicase INO80 OS=Candida alb... 30 5.1
sp|Q5HAN4|MNMG_EHRRW tRNA uridine 5-carboxymethylaminomethyl mod... 30 5.2
sp|Q55GR7|ELMOF_DICDI ELMO domain-containing protein F OS=Dictyo... 30 5.2
sp|P38616|YGP1_YEAST Protein YGP1 OS=Saccharomyces cerevisiae GN... 30 6.8

>sp|Q571K4|TAB3_MOUSE Mitogen-activated protein kinase kinase kinase
7-interacting protein 3 OS=Mus musculus GN=Map3k7ip3
PE=2 SV=2
Length = 716

Score = 35.0 bits (79), Expect = 0.16
Identities = 35/119 (29%), Positives = 47/119 (39%), Gaps = 13/119 (10%)
Frame = -3

Query: 427 QFPDYCPGHSNQPQPLSPHGWAKHLSLHPH*QYLSMKLYTPQPAQ--QTIQTSWMMSQCA 254
Q P P S+ PQ PH + L ++PH Q Y+P+ Q Q++ S SQC
Sbjct: 243 QTPQNAPWQSS-PQGPVPHYSQRPLPVYPHQQNYQPSQYSPKQQQIPQSVYHSPPPSQCP 301

Query: 253 N------CQCMAPGLNRP--HLL---TSETQGPQFLDDGSPIYQYCEPHSDGQYVYSKS 110
+ Q P L P H+ + T P G P YQ HS Y+ S
Sbjct: 302 SPFSSPQHQVQPPQLGHPSSHVFMPPSPSTTPPHLYQQGPPSYQKPGSHSVAYLPYTAS 360


>sp|Q3MIF2|LMBL2_RAT Lethal(3)malignant brain tumor-like 2 protein
OS=Rattus norvegicus GN=L3mbtl2 PE=2 SV=1
Length = 703

Score = 32.3 bits (72), Expect = 1.1
Identities = 23/64 (35%), Positives = 31/64 (48%)
Frame = +1

Query: 178 QETADLEFLMSEDVDDSSQEPCIDSWRTVTSSSLSELSAEQVEGYIASLRGIVNEDEETG 357
+ET E + E+ DD DS+R+ SS+ SE S+ Y+ NED E G
Sbjct: 8 EETPSSEPMEEEEDDDLELFGGYDSFRSYNSSAGSESSS-----YLEESSEAENEDREAG 62

Query: 358 VLPT 369
LPT
Sbjct: 63 ELPT 66


>sp|Q54EQ9|Y1586_DICDI Putative uncharacterized protein DDB_G0291608
OS=Dictyostelium discoideum GN=DDB_G0291608 PE=4 SV=1
Length = 919

Score = 31.6 bits (70), Expect = 1.8
Identities = 15/38 (39%), Positives = 24/38 (63%)
Frame = -2

Query: 398 ESATTSVTTWVGKTPVSSSSLTIPLNEAIYPSTCSADN 285
+S T+S T +PVSSSS + P++ ++ P T S+ N
Sbjct: 39 DSPTSSPVTLSTSSPVSSSSSSSPISTSVVPPTSSSSN 76


>sp|P42835|EGT2_YEAST Protein EGT2 OS=Saccharomyces cerevisiae
GN=EGT2 PE=2 SV=1
Length = 1041

Score = 31.6 bits (70), Expect = 1.8
Identities = 18/65 (27%), Positives = 31/65 (47%)
Frame = -2

Query: 422 SRLLSGTFESATTSVTTWVGKTPVSSSSLTIPLNEAIYPSTCSADNSDKLDDVTVRQLSM 243
S LLS T ++ T+ TT + SS + T LN+++ T +D + Q++
Sbjct: 676 SSLLSSTIDTKVTTATTSTSRDGSSSLAFTTGLNQSVVTGTDKSDTYSVISSTESAQVTE 735

Query: 242 HGSWL 228
+ S L
Sbjct: 736 YDSLL 740


>sp|P66716|RPOE_STAAW Probable DNA-directed RNA polymerase subunit
delta OS=Staphylococcus aureus (strain MW2) GN=rpoE PE=3
SV=1
Length = 176

Score = 31.6 bits (70), Expect = 1.8
Identities = 20/65 (30%), Positives = 32/65 (49%)
Frame = +1

Query: 157 DILDFHHQETADLEFLMSEDVDDSSQEPCIDSWRTVTSSSLSELSAEQVEGYIASLRGIV 336
DILD +E +L+ L +++DD P +T L++ EQVE I ++
Sbjct: 99 DILDADDEEDQNLKLLGEDEMDDDDDIPA----QTDDQEELNDPEDEQVEEEINHSDIVI 154

Query: 337 NEDEE 351
EDE+
Sbjct: 155 EEDED 159


>sp|A8YY93|RPOE_STAAT Probable DNA-directed RNA polymerase subunit
delta OS=Staphylococcus aureus (strain USA300 / TCH1516)
GN=rpoE PE=3 SV=1
Length = 176

Score = 31.6 bits (70), Expect = 1.8
Identities = 20/65 (30%), Positives = 32/65 (49%)
Frame = +1

Query: 157 DILDFHHQETADLEFLMSEDVDDSSQEPCIDSWRTVTSSSLSELSAEQVEGYIASLRGIV 336
DILD +E +L+ L +++DD P +T L++ EQVE I ++
Sbjct: 99 DILDADDEEDQNLKLLGEDEMDDDDDIPA----QTDDQEELNDPEDEQVEEEINHSDIVI 154

Query: 337 NEDEE 351
EDE+
Sbjct: 155 EEDED 159


>sp|Q6G7I2|RPOE_STAAS Probable DNA-directed RNA polymerase subunit
delta OS=Staphylococcus aureus (strain MSSA476) GN=rpoE
PE=3 SV=1
Length = 176

Score = 31.6 bits (70), Expect = 1.8
Identities = 20/65 (30%), Positives = 32/65 (49%)
Frame = +1

Query: 157 DILDFHHQETADLEFLMSEDVDDSSQEPCIDSWRTVTSSSLSELSAEQVEGYIASLRGIV 336
DILD +E +L+ L +++DD P +T L++ EQVE I ++
Sbjct: 99 DILDADDEEDQNLKLLGEDEMDDDDDIPA----QTDDQEELNDPEDEQVEEEINHSDIVI 154

Query: 337 NEDEE 351
EDE+
Sbjct: 155 EEDED 159


>sp|Q6GEU7|RPOE_STAAR Probable DNA-directed RNA polymerase subunit
delta OS=Staphylococcus aureus (strain MRSA252) GN=rpoE
PE=3 SV=1
Length = 176

Score = 31.6 bits (70), Expect = 1.8
Identities = 20/65 (30%), Positives = 32/65 (49%)
Frame = +1

Query: 157 DILDFHHQETADLEFLMSEDVDDSSQEPCIDSWRTVTSSSLSELSAEQVEGYIASLRGIV 336
DILD +E +L+ L +++DD P +T L++ EQVE I ++
Sbjct: 99 DILDADDEEDQNLKLLGEDEMDDDDDIPA----QTDDQEELNDPEDEQVEEEINHSDIVI 154

Query: 337 NEDEE 351
EDE+
Sbjct: 155 EEDED 159


>sp|P66715|RPOE_STAAN Probable DNA-directed RNA polymerase subunit
delta OS=Staphylococcus aureus (strain N315) GN=rpoE
PE=1 SV=1
Length = 176

Score = 31.6 bits (70), Expect = 1.8
Identities = 20/65 (30%), Positives = 32/65 (49%)
Frame = +1

Query: 157 DILDFHHQETADLEFLMSEDVDDSSQEPCIDSWRTVTSSSLSELSAEQVEGYIASLRGIV 336
DILD +E +L+ L +++DD P +T L++ EQVE I ++
Sbjct: 99 DILDADDEEDQNLKLLGEDEMDDDDDIPA----QTDDQEELNDPEDEQVEEEINHSDIVI 154

Query: 337 NEDEE 351
EDE+
Sbjct: 155 EEDED 159


>sp|P66714|RPOE_STAAM Probable DNA-directed RNA polymerase subunit
delta OS=Staphylococcus aureus (strain Mu50 / ATCC
700699) GN=rpoE PE=3 SV=1
Length = 176

Score = 31.6 bits (70), Expect = 1.8
Identities = 20/65 (30%), Positives = 32/65 (49%)
Frame = +1

Query: 157 DILDFHHQETADLEFLMSEDVDDSSQEPCIDSWRTVTSSSLSELSAEQVEGYIASLRGIV 336
DILD +E +L+ L +++DD P +T L++ EQVE I ++
Sbjct: 99 DILDADDEEDQNLKLLGEDEMDDDDDIPA----QTDDQEELNDPEDEQVEEEINHSDIVI 154

Query: 337 NEDEE 351
EDE+
Sbjct: 155 EEDED 159


tr_hit_id B3NH03
Definition tr|B3NH03|B3NH03_DROER GG13891 OS=Drosophila erecta
Align length 130
Score (bit) 40.0
E-value 0.059
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916217|Adiantum capillus-veneris mRNA, clone:
YMU001_000084_F07.
(465 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B3NH03|B3NH03_DROER GG13891 OS=Drosophila erecta GN=GG13891 P... 40 0.059
tr|A2E2C1|A2E2C1_TRIVA Putative uncharacterized protein OS=Trich... 39 0.13
tr|Q6FUJ4|Q6FUJ4_CANGA Strain CBS138 chromosome F complete seque... 37 0.38
tr|A8X669|A8X669_CAEBR Putative uncharacterized protein OS=Caeno... 36 0.85
tr|B4J9C8|B4J9C8_DROGR GH21424 OS=Drosophila grimshawi GN=GH2142... 35 1.4
tr|B1ASY9|B1ASY9_MOUSE Mitogen-activated protein kinase kinase k... 35 1.8
tr|A6FJR4|A6FJR4_9GAMM Hypothetical methyl-accepting chemotaxis ... 35 1.9
tr|Q8JL48|Q8JL48_9CAUD Capsid protein gpC OS=Natrialba phage Phi... 35 1.9
tr|Q87V39|Q87V39_PSESM Membrane protein, putative OS=Pseudomonas... 35 2.5
tr|Q4ZZC3|Q4ZZC3_PSEU2 Membrane protein, putative OS=Pseudomonas... 35 2.5
tr|Q5U7D5|Q5U7D5_9BACI OpuAC OS=Halobacillus trueperi GN=opuAC P... 35 2.5
tr|A4BEB9|A4BEB9_9GAMM Adenylosuccinate synthetase OS=Reinekea s... 35 2.5
tr|A5DJ03|A5DJ03_PICGU Putative uncharacterized protein OS=Pichi... 35 2.5
tr|Q32N62|Q32N62_XENLA LOC733423 protein (Fragment) OS=Xenopus l... 34 3.2
tr|A3Z0F5|A3Z0F5_9SYNE Putative uncharacterized protein OS=Synec... 34 3.2
tr|Q1RLF5|Q1RLF5_CIOIN Zinc finger protein OS=Ciona intestinalis... 34 3.2
tr|B6P191|B6P191_BRAFL Putative uncharacterized protein OS=Branc... 34 3.2
tr|A2DY67|A2DY67_TRIVA Gene 11-1 protein, putative OS=Trichomona... 34 4.2
tr|Q1J1L9|Q1J1L9_DEIGD Putative uncharacterized protein OS=Deino... 33 5.4
tr|A1CRF0|A1CRF0_ASPCL C2H2 transcription factor (TFIIIA), putat... 33 5.4
tr|Q7RMI6|Q7RMI6_PLAYO Putative uncharacterized protein PY02194 ... 33 5.5
tr|Q17AN2|Q17AN2_AEDAE Lateral signaling target protein OS=Aedes... 33 5.5
tr|B0WY89|B0WY89_CULQU Microtubule binding protein D-CLIP-190 OS... 33 5.5
tr|Q2W276|Q2W276_MAGMM Putative uncharacterized protein OS=Magne... 33 7.2
tr|Q2QWM9|Q2QWM9_ORYSJ Os12g0190000 protein OS=Oryza sativa subs... 33 7.2
tr|B8BNI6|B8BNI6_ORYSI Putative uncharacterized protein OS=Oryza... 33 7.2
tr|A3CFM4|A3CFM4_ORYSJ Putative uncharacterized protein OS=Oryza... 33 7.2
tr|B3S522|B3S522_TRIAD Predicted protein OS=Trichoplax adhaerens... 33 7.2
tr|Q59XA7|Q59XA7_CANAL Possible cell wall protein OS=Candida alb... 33 7.2
tr|A8WQ89|A8WQ89_CAEBR Putative uncharacterized protein OS=Caeno... 33 9.1

>tr|B3NH03|B3NH03_DROER GG13891 OS=Drosophila erecta GN=GG13891 PE=4
SV=1
Length = 1010

Score = 40.0 bits (92), Expect = 0.059
Identities = 36/130 (27%), Positives = 57/130 (43%), Gaps = 8/130 (6%)
Frame = +1

Query: 67 ESSTQNAQGCNAFDDSLSTRIAHQSEAHNTDILDFHHQETADLE-FLMSEDVDDSSQEPC 243
ESSTQ + DD+ + I S + D A LE ++S + S+QE
Sbjct: 171 ESSTQESSTGVPEDDASTESIQESSTLESRSSTDISLSTEASLEDIILSSESSSSTQE-- 228

Query: 244 IDSWRTVTSSSLSELSAEQVEGYIASLRGIVNEDEETGV---LPTHVVTEVV----ADSN 402
SW + SS +EL + + +S + N +E+ LPT TEV + +
Sbjct: 229 --SWSSSESSIYTELPSTEATDESSSTESLPNSTQESTTESPLPTESSTEVTDQPSSTES 286

Query: 403 VPDNNLETES 432
+PD+ E+ S
Sbjct: 287 IPDSTQESTS 296


>tr|A2E2C1|A2E2C1_TRIVA Putative uncharacterized protein
OS=Trichomonas vaginalis G3 GN=TVAG_097910 PE=4 SV=1
Length = 9597

Score = 38.9 bits (89), Expect = 0.13
Identities = 39/154 (25%), Positives = 71/154 (46%), Gaps = 5/154 (3%)
Frame = +1

Query: 10 DASYDHALQLSKQEDVLNKESSTQNAQGCNAFDDSLSTRIAHQSEAHNTDILDFHHQETA 189
+ S + + +K ++V + +S + Q ++ D S T S + +T + +
Sbjct: 7506 EESKSNVSEKAKYKEVESPDSVDSHRQFNSSVDTSSETA---SSVSQSTSKHMQENSNDS 7562

Query: 190 DLEFLMSEDVDDSSQEPC-IDSWRTVTSSSLSELS--AEQVEGYIASLRGIVNEDE--ET 354
D D+ + E +D RTV SSS S+ S +EQ IASL+ IV + +T
Sbjct: 7563 DSSIPQKRDIKSTKSESSHVDDIRTVKSSSSSKSSTVSEQSADSIASLQSIVESSDYIDT 7622

Query: 355 GVLPTHVVTEVVADSNVPDNNLETESGPKGSQGV 456
LP + +V+D++ +N +S + S+ V
Sbjct: 7623 SDLPESTIDSLVSDASQRKDNESKDSSNEKSKKV 7656



Score = 38.1 bits (87), Expect = 0.22
Identities = 34/133 (25%), Positives = 58/133 (43%), Gaps = 3/133 (2%)
Frame = +1

Query: 67 ESSTQNAQGCNAFDDSLSTR--IAHQSEAHNTDILDFHHQETADLEFLMSEDVDDSSQEP 240
ES +++ ++ D S T I++ + HN + T D ++ D+ S+
Sbjct: 5741 ESESKSRLYIDSVDTSTQTESDISNDTSRHNQEASIIDEDTTTDDNKVVRAIKDNKSESS 5800

Query: 241 CIDSWRTVTSSSLSELSAEQVEGYIASLRGIVNEDE-ETGVLPTHVVTEVVADSNVPDNN 417
D +TV SSS S ++EQ IASL+ +E T LP + +V+D
Sbjct: 5801 NFDDIKTVKSSSKSATTSEQSVQTIASLQSRNDESSISTSDLPESTIDSLVSDVEYRKGK 5860

Query: 418 LETESGPKGSQGV 456
+S + S+ V
Sbjct: 5861 ESNDSSNEKSKKV 5873



Score = 35.4 bits (80), Expect = 1.4
Identities = 39/155 (25%), Positives = 68/155 (43%), Gaps = 8/155 (5%)
Frame = +1

Query: 10 DASYDHALQLSKQEDVLNKESSTQNAQGCNAFDDSLSTRIAHQSEAHNTDILDFHHQETA 189
+ S + + +K +++ + +S + Q F+ S++T S + + H QE
Sbjct: 6956 EESISNVSEKAKYKEIESPDSVDSHRQ----FNSSINTYSETASSVSQS--VSNHMQENT 7009

Query: 190 DLEFL---MSEDVDDSSQEPC-IDSWRTVTSSSLSELS--AEQVEGYIASLRGIVNEDE- 348
+ + D+ + E +D RTV SSS S+ S +EQ IASL+ IV +
Sbjct: 7010 NDSYSSIPQKRDIKSTKSESSHVDDIRTVKSSSSSKSSTVSEQSADSIASLQSIVESSDY 7069

Query: 349 -ETGVLPTHVVTEVVADSNVPDNNLETESGPKGSQ 450
+T LP + +V+D+ E S K Q
Sbjct: 7070 IDTSDLPESTIDSLVSDAGPKKEVTENNSKDKSIQ 7104


>tr|Q6FUJ4|Q6FUJ4_CANGA Strain CBS138 chromosome F complete sequence
OS=Candida glabrata GN=CAGL0F03003g PE=4 SV=1
Length = 1185

Score = 37.4 bits (85), Expect = 0.38
Identities = 38/152 (25%), Positives = 62/152 (40%), Gaps = 8/152 (5%)
Frame = +1

Query: 1 SRCDASYDHALQLSK--QEDVLNKESSTQNAQGCNAF----DDSLSTRIAHQSEAHNTDI 162
SR DASY Q S Q N +S +A N D++ +T + A N D+
Sbjct: 531 SRDDASYAEIAQSSVNVQNSASNFANSVPSADSSNTIPQPEDNTPTTSTVSEFTASNVDV 590

Query: 163 LDFHHQETADLEFLMSEDVDDSSQEPCIDSWRTVTSSSLSELSAEQVEGYIASLRGIVNE 342
H + S+D D S +V++ A V+ I S I +
Sbjct: 591 SSVH---------IASKDADSSPN--------SVSNHDALNSVAPSVDVDIVSSNSIPTQ 633

Query: 343 --DEETGVLPTHVVTEVVADSNVPDNNLETES 432
E + +P +V ++ +D N+P N+E++S
Sbjct: 634 VLTEPSSAVPPNVGFDISSDINIPSENIESDS 665


>tr|A8X669|A8X669_CAEBR Putative uncharacterized protein
OS=Caenorhabditis briggsae GN=CBG08273 PE=4 SV=1
Length = 1307

Score = 36.2 bits (82), Expect = 0.85
Identities = 29/99 (29%), Positives = 43/99 (43%), Gaps = 5/99 (5%)
Frame = +1

Query: 154 TDILDFHHQ--ETADLEFLMSEDVDDSSQEPCIDSWRTVTSSSLSELSAEQVEGYIASL- 324
TD+ + + + E DL + SE VD SSQEP + + L + EQVE I +
Sbjct: 42 TDVTEINEEVTENTDLPLVTSEKVDVSSQEPVVVDEEKQKENELDKSKTEQVEEAIQEIE 101

Query: 325 --RGIVNEDEETGVLPTHVVTEVVADSNVPDNNLETESG 435
+ E+ E HV VA+ + N +SG
Sbjct: 102 QEEKVDVENLEDKEEEEHVDELEVAEEGAEEGNDSVDSG 140


>tr|B4J9C8|B4J9C8_DROGR GH21424 OS=Drosophila grimshawi GN=GH21424
PE=4 SV=1
Length = 1995

Score = 35.4 bits (80), Expect = 1.4
Identities = 26/64 (40%), Positives = 32/64 (50%), Gaps = 4/64 (6%)
Frame = -2

Query: 440 LGPDSVSRLLSGTFESATTSVTTWVGKTPVSSSSLTIPLNEAIYPSTCSAD----NSDKL 273
L PD+ SGT SA TS T+ PV SSS + N A +T +AD S K
Sbjct: 1921 LSPDTACGSASGTGGSAVTSTTSGSNTPPVVSSSTSSSGNVATAATTAAADVAASASAKT 1980

Query: 272 DDVT 261
D+VT
Sbjct: 1981 DEVT 1984


>tr|B1ASY9|B1ASY9_MOUSE Mitogen-activated protein kinase kinase
kinase 7 interacting protein 3 OS=Mus musculus
GN=Map3k7ip3 PE=2 SV=1
Length = 716

Score = 35.0 bits (79), Expect = 1.8
Identities = 35/119 (29%), Positives = 47/119 (39%), Gaps = 13/119 (10%)
Frame = -3

Query: 427 QFPDYCPGHSNQPQPLSPHGWAKHLSLHPH*QYLSMKLYTPQPAQ--QTIQTSWMMSQCA 254
Q P P S+ PQ PH + L ++PH Q Y+P+ Q Q++ S SQC
Sbjct: 243 QTPQNAPWQSS-PQGPVPHYSQRPLPVYPHQQNYQPSQYSPKQQQIPQSVYHSPPPSQCP 301

Query: 253 N------CQCMAPGLNRP--HLL---TSETQGPQFLDDGSPIYQYCEPHSDGQYVYSKS 110
+ Q P L P H+ + T P G P YQ HS Y+ S
Sbjct: 302 SPFSSPQHQVQPPQLGHPSSHVFMPPSPSTTPPHLYQQGPPSYQKPGSHSVAYLPYTAS 360


>tr|A6FJR4|A6FJR4_9GAMM Hypothetical methyl-accepting chemotaxis
protein (Fragment) OS=Moritella sp. PE36 GN=PE36_10343
PE=4 SV=1
Length = 468

Score = 35.0 bits (79), Expect = 1.9
Identities = 40/173 (23%), Positives = 69/173 (39%), Gaps = 32/173 (18%)
Frame = +1

Query: 37 LSKQEDVLNKESSTQNAQGCNAFDDSLSTRIAHQSEA----------------HNTDILD 168
L+++ +V +K+ Q A+G N F +L + + S++ HN +L
Sbjct: 159 LTQRLEVTSKDDLGQIAEGVNTFISNLQSIMLEISQSTTHISTGIEQLRTQTEHNNTVLI 218

Query: 169 FHHQETADLEFL---MSEDVDDSSQEPCIDSWRTVTSSSLSELSAEQVEGYIASLRGIVN 339
H ET + MS D +Q + T SS + S V+G + + +VN
Sbjct: 219 DHASETDQVVVAVTEMSSTADSVAQSAAQSATFTQKSSDEAHQSKIVVQGAVNGVADLVN 278

Query: 340 E-----------DEETGVLP--THVVTEVVADSNVPDNNLETESGPKGSQGVG 459
E +E+T + V+ E+ +N+ N E+ G QG G
Sbjct: 279 EVEAMALNIQTMNEDTNKISKVLSVIGEIADQTNLLALNAAIEAARAGEQGRG 331


>tr|Q8JL48|Q8JL48_9CAUD Capsid protein gpC OS=Natrialba phage PhiCh1
PE=4 SV=1
Length = 315

Score = 35.0 bits (79), Expect = 1.9
Identities = 23/75 (30%), Positives = 31/75 (41%), Gaps = 1/75 (1%)
Frame = +1

Query: 211 EDVDDSSQEPCIDSWRTVTSSSLSELSAEQVEGY-IASLRGIVNEDEETGVLPTHVVTEV 387
E +DD E + T+T S S L EG I ++G +NED G L HV
Sbjct: 129 ESIDDWVDEAAGSTLETITEDSTSWLRGAHEEGLSIPEIQGQINEDLFEGRLEDHVAERA 188

Query: 388 VADSNVPDNNLETES 432
+ +NL S
Sbjct: 189 ARTGTISTSNLGVHS 203


>tr|Q87V39|Q87V39_PSESM Membrane protein, putative OS=Pseudomonas
syringae pv. tomato GN=PSPTO5102 PE=4 SV=1
Length = 791

Score = 34.7 bits (78), Expect = 2.5
Identities = 16/51 (31%), Positives = 27/51 (52%)
Frame = +1

Query: 181 ETADLEFLMSEDVDDSSQEPCIDSWRTVTSSSLSELSAEQVEGYIASLRGI 333
E A L+ L ++D+D + Q P + WRT+ + + + I SLRG+
Sbjct: 560 ELAQLQALPTQDIDQALQGPLSEQWRTLWLGASEDAEGDAQVASIVSLRGL 610


>tr|Q4ZZC3|Q4ZZC3_PSEU2 Membrane protein, putative OS=Pseudomonas
syringae pv. syringae (strain B728a) GN=Psyr_0429 PE=3
SV=1
Length = 791

Score = 34.7 bits (78), Expect = 2.5
Identities = 18/51 (35%), Positives = 28/51 (54%)
Frame = +1

Query: 181 ETADLEFLMSEDVDDSSQEPCIDSWRTVTSSSLSELSAEQVEGYIASLRGI 333
E A L+ L ++DVD + Q P + WRT+ + + +Q I SLRG+
Sbjct: 560 ELAQLQALPTQDVDQALQGPLSEPWRTLWLGPTRDDNGDQGVASIVSLRGM 610