BP916226
Clone id YMU001_000084_G07
Library
Length 352
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000084_G07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TGAAAGCTCCTACCAGCAACATCACCATCATAACCTTTGAGAGGATATCGTACTTTTGTA
TTCCTGACTGCTTTGAAGAGGGCATATCCCAACACTCGTTGGGCATCAATATCTTCCACA
CAATCTGCAAGATCTAGCTCTAGCAGTTTCAGGTAGCCACCTGGTTGTAGAAGCTCTCCC
ACTATACGGTCCGGCTCCGTTATATCCCTCTCAATCACGAAAAGCTTTCTTCCATCCTTT
CCAAGAGCATACGCAAGGGCCGACCCGGCGACACCTGCCCCTACAACAATCACATCAATG
GCGTCTGATCTCTCTGACAAATCCACAATATTGTCATCGGCAATGGGTGCAA
■■Homology search results ■■ -
sp_hit_id O48651
Definition sp|O48651|ERG1_PANGI Squalene monooxygenase OS=Panax ginseng
Align length 78
Score (bit) 114.0
E-value 1.0e-25
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916226|Adiantum capillus-veneris mRNA, clone:
YMU001_000084_G07.
(352 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O48651|ERG1_PANGI Squalene monooxygenase OS=Panax ginseng PE=... 114 1e-25
sp|Q9C1W3|ERG1_SCHPO Probable squalene monooxygenase OS=Schizosa... 78 2e-14
sp|O65402|ERG12_ARATH Squalene monooxygenase 1,2 OS=Arabidopsis ... 77 2e-14
sp|Q14534|ERG1_HUMAN Squalene monooxygenase OS=Homo sapiens GN=S... 77 3e-14
sp|O65404|ERG11_ARATH Squalene monooxygenase 1,1 OS=Arabidopsis ... 76 6e-14
sp|P52019|ERG1_MOUSE Squalene monooxygenase OS=Mus musculus GN=S... 74 2e-13
sp|O65726|ERG12_BRANA Squalene monooxygenase 1,2 OS=Brassica nap... 74 2e-13
sp|O65403|ERG13_ARATH Squalene monooxygenase 2 OS=Arabidopsis th... 70 2e-12
sp|P52020|ERG1_RAT Squalene monooxygenase OS=Rattus norvegicus G... 70 4e-12
sp|O65727|ERG11_BRANA Squalene monooxygenase 1,1 OS=Brassica nap... 69 9e-12
sp|O13306|ERG1_CANGA Squalene monooxygenase OS=Candida glabrata ... 63 5e-10
sp|P32476|ERG1_YEAST Squalene monooxygenase OS=Saccharomyces cer... 60 3e-09
sp|Q92206|ERG1_CANAL Squalene monooxygenase OS=Candida albicans ... 57 3e-08
sp|Q75F69|ERG1_ASHGO Squalene monooxygenase OS=Ashbya gossypii G... 55 1e-07

>sp|O48651|ERG1_PANGI Squalene monooxygenase OS=Panax ginseng PE=2
SV=1
Length = 539

Score = 114 bits (285), Expect = 1e-25
Identities = 54/78 (69%), Positives = 65/78 (83%)
Frame = -3

Query: 236 DGRKLFVIERDITEPDRIVGELLQPGGYLKLLELDLADCVEDIDAQRVLGYALFKAVRNT 57
DGR++ VIERD+TE DRIVGELLQPGGYLKL+EL L DCV +IDAQRV GYAL+ +NT
Sbjct: 96 DGRRVHVIERDLTEQDRIVGELLQPGGYLKLIELGLEDCVNEIDAQRVFGYALYMDGKNT 155

Query: 56 KVRYPLKGYDGDVAGRSF 3
++ YPL+ + DVAGRSF
Sbjct: 156 RLSYPLEKFHSDVAGRSF 173


>sp|Q9C1W3|ERG1_SCHPO Probable squalene monooxygenase
OS=Schizosaccharomyces pombe GN=SPBC713.12 PE=2 SV=1
Length = 457

Score = 77.8 bits (190), Expect = 2e-14
Identities = 40/79 (50%), Positives = 49/79 (62%)
Frame = -3

Query: 239 KDGRKLFVIERDITEPDRIVGELLQPGGYLKLLELDLADCVEDIDAQRVLGYALFKAVRN 60
+ GRK+ V+ERD++EPDRIVGELLQPGG L ++ +AD VE ID Q GY +F N
Sbjct: 26 RQGRKVLVLERDMSEPDRIVGELLQPGGIEALEKIGIADAVEGIDGQWTSGYQIFYGDSN 85

Query: 59 TKVRYPLKGYDGDVAGRSF 3
V YP K G G F
Sbjct: 86 VSVPYPSKPNGGAYQGIGF 104


>sp|O65402|ERG12_ARATH Squalene monooxygenase 1,2 OS=Arabidopsis
thaliana GN=SQP1,2 PE=2 SV=1
Length = 517

Score = 77.4 bits (189), Expect = 2e-14
Identities = 37/81 (45%), Positives = 55/81 (67%), Gaps = 2/81 (2%)
Frame = -3

Query: 239 KDGRKLFVIERDITEPDRIVGELLQPGGYLKLLELDLADCVEDIDAQRVLGYALFKAVRN 60
KDGR++ VIERD+ EP+R++GE +QPGG L L +L L DC+EDIDAQ+ G A++K +
Sbjct: 66 KDGRRVHVIERDMREPERMMGEFMQPGGRLMLSKLGLQDCLEDIDAQKATGLAVYKDGKE 125

Query: 59 TKVRYPL--KGYDGDVAGRSF 3
+P+ + + + RSF
Sbjct: 126 ADAPFPVDNNNFSYEPSARSF 146


>sp|Q14534|ERG1_HUMAN Squalene monooxygenase OS=Homo sapiens GN=SQLE
PE=2 SV=2
Length = 574

Score = 77.0 bits (188), Expect = 3e-14
Identities = 42/81 (51%), Positives = 54/81 (66%), Gaps = 2/81 (2%)
Frame = -3

Query: 239 KDGRKLFVIERDITEPDRIVGELLQPGGYLKLLELDLADCVEDIDAQRVLGYALFKAVRN 60
+DGRK+ VIERD+ EPDRIVGE LQPGGY L +L L D VE +DAQ V GY +
Sbjct: 144 RDGRKVTVIERDLKEPDRIVGEFLQPGGYHVLKDLGLGDTVEGLDAQVVNGYMIHDQESK 203

Query: 59 TKVR--YPLKGYDGDVAGRSF 3
++V+ YPL + +GR+F
Sbjct: 204 SEVQIPYPLSENNQVQSGRAF 224


>sp|O65404|ERG11_ARATH Squalene monooxygenase 1,1 OS=Arabidopsis
thaliana GN=SQP1,1 PE=2 SV=2
Length = 516

Score = 75.9 bits (185), Expect = 6e-14
Identities = 37/81 (45%), Positives = 53/81 (65%), Gaps = 2/81 (2%)
Frame = -3

Query: 239 KDGRKLFVIERDITEPDRIVGELLQPGGYLKLLELDLADCVEDIDAQRVLGYALFKAVRN 60
KDGR++ VIERD+ EP+RI+GE +QPGG L L +L L DC+E IDAQ+ G ++K +
Sbjct: 66 KDGRRVHVIERDLREPERIMGEFMQPGGRLMLSKLGLEDCLEGIDAQKATGMTVYKDGKE 125

Query: 59 TKVRYPL--KGYDGDVAGRSF 3
+P+ + D + RSF
Sbjct: 126 AVASFPVDNNNFPFDPSARSF 146


>sp|P52019|ERG1_MOUSE Squalene monooxygenase OS=Mus musculus GN=Sqle
PE=2 SV=1
Length = 572

Score = 74.3 bits (181), Expect = 2e-13
Identities = 39/81 (48%), Positives = 54/81 (66%), Gaps = 2/81 (2%)
Frame = -3

Query: 239 KDGRKLFVIERDITEPDRIVGELLQPGGYLKLLELDLADCVEDIDAQRVLGYAL--FKAV 66
+DGRK+ VIERD+ EPDRIVGELLQPGGY L EL L D VE ++A + GY + +++
Sbjct: 142 RDGRKVTVIERDLKEPDRIVGELLQPGGYRVLQELGLGDTVEGLNAHHIHGYIVHDYESR 201

Query: 65 RNTKVRYPLKGYDGDVAGRSF 3
++ YPL + +G +F
Sbjct: 202 SEVQIPYPLSETNQVQSGIAF 222


>sp|O65726|ERG12_BRANA Squalene monooxygenase 1,2 OS=Brassica napus
GN=SQP1,2 PE=2 SV=1
Length = 518

Score = 74.3 bits (181), Expect = 2e-13
Identities = 38/80 (47%), Positives = 54/80 (67%), Gaps = 1/80 (1%)
Frame = -3

Query: 239 KDGRKLFVIERDITEPDRIVGELLQPGGYLKLLELDLADCVEDIDAQRVLGYALFKAVRN 60
KDGR++ VIERD+ EP R++GE +QPGG L L +L L DC+E+IDAQ+ G LFK +
Sbjct: 69 KDGRRVHVIERDMREPVRMMGEFMQPGGRLMLSKLGLQDCLEEIDAQKSTGIRLFKDGKE 128

Query: 59 TKVRYPL-KGYDGDVAGRSF 3
T +P+ + + +GR F
Sbjct: 129 TVACFPVDTNFPYEPSGRFF 148


>sp|O65403|ERG13_ARATH Squalene monooxygenase 2 OS=Arabidopsis
thaliana GN=SQP2 PE=2 SV=1
Length = 516

Score = 70.5 bits (171), Expect = 2e-12
Identities = 32/66 (48%), Positives = 45/66 (68%)
Frame = -3

Query: 239 KDGRKLFVIERDITEPDRIVGELLQPGGYLKLLELDLADCVEDIDAQRVLGYALFKAVRN 60
KDGR++ VIERD+ EP R +GEL+Q GG L +L L DC+EDIDAQ A++K ++
Sbjct: 64 KDGRRVHVIERDLKEPQRFMGELMQAGGRFMLAQLGLEDCLEDIDAQEAKSLAIYKDGKH 123

Query: 59 TKVRYP 42
+ +P
Sbjct: 124 ATLPFP 129


>sp|P52020|ERG1_RAT Squalene monooxygenase OS=Rattus norvegicus
GN=Sqle PE=2 SV=1
Length = 573

Score = 69.7 bits (169), Expect = 4e-12
Identities = 33/66 (50%), Positives = 44/66 (66%)
Frame = -3

Query: 239 KDGRKLFVIERDITEPDRIVGELLQPGGYLKLLELDLADCVEDIDAQRVLGYALFKAVRN 60
+DGR + VIERD+ EPDRI+GE LQPGGY L EL L D VE ++A + GY +
Sbjct: 143 RDGRTVTVIERDLKEPDRILGECLQPGGYRVLRELGLGDTVESLNAHHIHGYVIHDCESR 202

Query: 59 TKVRYP 42
++V+ P
Sbjct: 203 SEVQIP 208


>sp|O65727|ERG11_BRANA Squalene monooxygenase 1,1 OS=Brassica napus
GN=SQP1,1 PE=2 SV=1
Length = 506

Score = 68.6 bits (166), Expect = 9e-12
Identities = 36/80 (45%), Positives = 51/80 (63%), Gaps = 1/80 (1%)
Frame = -3

Query: 239 KDGRKLFVIERDITEPDRIVGELLQPGGYLKLLELDLADCVEDIDAQRVLGYALFKAVRN 60
KDGR++ VIERD+ EP R++GE +QPGG L L +L L DC+E ID Q G A++K +
Sbjct: 68 KDGRRVHVIERDMREPVRMMGEFMQPGGRLLLSKLGLEDCLEGIDEQIATGLAVYKDGQK 127

Query: 59 TKVRYPL-KGYDGDVAGRSF 3
V +P + + GR+F
Sbjct: 128 ALVSFPEDNDFPYEPTGRAF 147


tr_hit_id B8A3C6
Definition tr|B8A3C6|B8A3C6_MAIZE Putative uncharacterized protein OS=Zea mays
Align length 79
Score (bit) 128.0
E-value 1.0e-28
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916226|Adiantum capillus-veneris mRNA, clone:
YMU001_000084_G07.
(352 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8A3C6|B8A3C6_MAIZE Putative uncharacterized protein OS=Zea m... 128 1e-28
tr|B6U6N2|B6U6N2_MAIZE Squalene monooxygenase OS=Zea mays PE=2 SV=1 128 1e-28
tr|B4G0B2|B4G0B2_MAIZE Putative uncharacterized protein OS=Zea m... 128 1e-28
tr|A7NUD3|A7NUD3_VITVI Chromosome chr18 scaffold_1, whole genome... 127 2e-28
tr|Q9T064|Q9T064_ARATH Squalene epoxidase-like protein OS=Arabid... 125 8e-28
tr|Q8VYH2|Q8VYH2_ARATH AT4g37760/T28I19_40 (Putative uncharacter... 125 8e-28
tr|Q8LFJ1|Q8LFJ1_ARATH Squalene epoxidase-like protein OS=Arabid... 125 8e-28
tr|Q8GTX8|Q8GTX8_ORYSJ Putative Squalene monooxygenase (Putative... 125 8e-28
tr|Q10PK6|Q10PK6_ORYSJ Squalene monooxygenase, putative, express... 125 8e-28
tr|Q10PK5|Q10PK5_ORYSJ Os03g0231700 protein OS=Oryza sativa subs... 125 8e-28
tr|A7R1V6|A7R1V6_VITVI Chromosome chr7 scaffold_382, whole genom... 125 8e-28
tr|A2XE79|A2XE79_ORYSI Putative uncharacterized protein OS=Oryza... 125 8e-28
tr|A9TRU6|A9TRU6_PHYPA Predicted protein OS=Physcomitrella paten... 125 1e-27
tr|Q8GTX7|Q8GTX7_ORYSJ Putative Squalene monooxygenase (Putative... 124 2e-27
tr|Q4A570|Q4A570_SOLLC Putative squalene epoxidase OS=Solanum ly... 124 2e-27
tr|Q10PK2|Q10PK2_ORYSJ Squalene monooxygenase, putative, express... 124 2e-27
tr|Q0DTR1|Q0DTR1_ORYSJ Os03g0231800 protein OS=Oryza sativa subs... 124 2e-27
tr|B8AJM0|B8AJM0_ORYSI Putative uncharacterized protein OS=Oryza... 124 2e-27
tr|A9NW92|A9NW92_PICSI Putative uncharacterized protein OS=Picea... 122 1e-26
tr|B6V3J2|B6V3J2_9MAGN Squalene epoxidase 1 OS=Nigella sativa GN... 120 3e-26
tr|A7VJN1|A7VJN1_EUPTI Squalene epoxidase OS=Euphorbia tirucalli... 119 1e-25
tr|Q8GSM9|Q8GSM9_MEDTR Squalene monooxygenase 2 OS=Medicago trun... 117 2e-25
tr|Q8GSM8|Q8GSM8_MEDTR Squalene monooxygenase 1 OS=Medicago trun... 117 2e-25
tr|Q506K3|Q506K3_DATIN Squalene monooxygenase OS=Datura innoxia ... 117 2e-25
tr|Q2HY08|Q2HY08_MEDSA Squalene epoxidase OS=Medicago sativa GN=... 117 2e-25
tr|A7QGY6|A7QGY6_VITVI Chromosome chr3 scaffold_95, whole genome... 117 3e-25
tr|O81000|O81000_ARATH Putative squalene epoxidase OS=Arabidopsi... 117 4e-25
tr|Q75W20|Q75W20_PANGI Squalene epoxidase OS=Panax ginseng PE=2 ... 116 6e-25
tr|Q1PID4|Q1PID4_9APIA Squalene epoxidase OS=Panax notoginseng P... 114 2e-24
tr|Q1KSF9|Q1KSF9_9APIA Squalene epoxidase OS=Panax notoginseng P... 114 2e-24

>tr|B8A3C6|B8A3C6_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 529

Score = 128 bits (322), Expect = 1e-28
Identities = 62/79 (78%), Positives = 70/79 (88%)
Frame = -3

Query: 239 KDGRKLFVIERDITEPDRIVGELLQPGGYLKLLELDLADCVEDIDAQRVLGYALFKAVRN 60
KDGR++ VIERD+TEPDRIVGELLQPGGYLKL+EL L DCVE+IDAQRVLGYALFK RN
Sbjct: 82 KDGRRVHVIERDLTEPDRIVGELLQPGGYLKLIELGLQDCVEEIDAQRVLGYALFKDGRN 141

Query: 59 TKVRYPLKGYDGDVAGRSF 3
TK+ YPL+ + DVAGRSF
Sbjct: 142 TKLAYPLEKFHSDVAGRSF 160


>tr|B6U6N2|B6U6N2_MAIZE Squalene monooxygenase OS=Zea mays PE=2 SV=1
Length = 539

Score = 128 bits (322), Expect = 1e-28
Identities = 62/79 (78%), Positives = 70/79 (88%)
Frame = -3

Query: 239 KDGRKLFVIERDITEPDRIVGELLQPGGYLKLLELDLADCVEDIDAQRVLGYALFKAVRN 60
KDGR++ VIERD+TEPDRIVGELLQPGGYLKL+EL L DCVE+IDAQRVLGYALFK RN
Sbjct: 94 KDGRRVHVIERDLTEPDRIVGELLQPGGYLKLIELGLQDCVEEIDAQRVLGYALFKDGRN 153

Query: 59 TKVRYPLKGYDGDVAGRSF 3
TK+ YPL+ + DVAGRSF
Sbjct: 154 TKLAYPLEKFHSDVAGRSF 172


>tr|B4G0B2|B4G0B2_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 529

Score = 128 bits (322), Expect = 1e-28
Identities = 62/79 (78%), Positives = 70/79 (88%)
Frame = -3

Query: 239 KDGRKLFVIERDITEPDRIVGELLQPGGYLKLLELDLADCVEDIDAQRVLGYALFKAVRN 60
KDGR++ VIERD+TEPDRIVGELLQPGGYLKL+EL L DCVE+IDAQRVLGYALFK RN
Sbjct: 82 KDGRRVHVIERDLTEPDRIVGELLQPGGYLKLIELGLQDCVEEIDAQRVLGYALFKDGRN 141

Query: 59 TKVRYPLKGYDGDVAGRSF 3
TK+ YPL+ + DVAGRSF
Sbjct: 142 TKLAYPLEKFHSDVAGRSF 160


>tr|A7NUD3|A7NUD3_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015002001
PE=4 SV=1
Length = 523

Score = 127 bits (320), Expect = 2e-28
Identities = 61/79 (77%), Positives = 70/79 (88%)
Frame = -3

Query: 239 KDGRKLFVIERDITEPDRIVGELLQPGGYLKLLELDLADCVEDIDAQRVLGYALFKAVRN 60
KDGR++ VIERD+TEPDRIVGELLQPGGYLKL+EL L DCVE+IDAQRV GYALFK +N
Sbjct: 79 KDGRRVRVIERDLTEPDRIVGELLQPGGYLKLIELGLQDCVEEIDAQRVFGYALFKDGKN 138

Query: 59 TKVRYPLKGYDGDVAGRSF 3
TK+ YPL+ +D DVAGRSF
Sbjct: 139 TKLSYPLEKFDSDVAGRSF 157


>tr|Q9T064|Q9T064_ARATH Squalene epoxidase-like protein
OS=Arabidopsis thaliana GN=AT4g37760 PE=2 SV=1
Length = 530

Score = 125 bits (315), Expect = 8e-28
Identities = 60/79 (75%), Positives = 70/79 (88%)
Frame = -3

Query: 239 KDGRKLFVIERDITEPDRIVGELLQPGGYLKLLELDLADCVEDIDAQRVLGYALFKAVRN 60
K+GR++ VIERD+TEPDRIVGELLQPGGYLKL+EL L DCV+DIDAQRVLGYALFK ++
Sbjct: 75 KEGRRVHVIERDLTEPDRIVGELLQPGGYLKLIELGLEDCVKDIDAQRVLGYALFKDGKH 134

Query: 59 TKVRYPLKGYDGDVAGRSF 3
TK+ YPL +D DVAGRSF
Sbjct: 135 TKLSYPLDQFDSDVAGRSF 153


>tr|Q8VYH2|Q8VYH2_ARATH AT4g37760/T28I19_40 (Putative
uncharacterized protein At4g37760) OS=Arabidopsis
thaliana GN=At4g37760 PE=2 SV=1
Length = 525

Score = 125 bits (315), Expect = 8e-28
Identities = 60/79 (75%), Positives = 70/79 (88%)
Frame = -3

Query: 239 KDGRKLFVIERDITEPDRIVGELLQPGGYLKLLELDLADCVEDIDAQRVLGYALFKAVRN 60
K+GR++ VIERD+TEPDRIVGELLQPGGYLKL+EL L DCV+DIDAQRVLGYALFK ++
Sbjct: 75 KEGRRVHVIERDLTEPDRIVGELLQPGGYLKLIELGLEDCVKDIDAQRVLGYALFKDGKH 134

Query: 59 TKVRYPLKGYDGDVAGRSF 3
TK+ YPL +D DVAGRSF
Sbjct: 135 TKLSYPLDQFDSDVAGRSF 153


>tr|Q8LFJ1|Q8LFJ1_ARATH Squalene epoxidase-like protein
OS=Arabidopsis thaliana PE=2 SV=1
Length = 525

Score = 125 bits (315), Expect = 8e-28
Identities = 60/79 (75%), Positives = 70/79 (88%)
Frame = -3

Query: 239 KDGRKLFVIERDITEPDRIVGELLQPGGYLKLLELDLADCVEDIDAQRVLGYALFKAVRN 60
K+GR++ VIERD+TEPDRIVGELLQPGGYLKL+EL L DCV+DIDAQRVLGYALFK ++
Sbjct: 75 KEGRRVHVIERDLTEPDRIVGELLQPGGYLKLIELGLEDCVKDIDAQRVLGYALFKDGKH 134

Query: 59 TKVRYPLKGYDGDVAGRSF 3
TK+ YPL +D DVAGRSF
Sbjct: 135 TKLSYPLDQFDSDVAGRSF 153


>tr|Q8GTX8|Q8GTX8_ORYSJ Putative Squalene monooxygenase (Putative
uncharacterized protein) (Squalene monooxygenase,
putative, expressed) OS=Oryza sativa subsp. japonica
GN=OJ1017C11.7 PE=4 SV=1
Length = 522

Score = 125 bits (315), Expect = 8e-28
Identities = 61/79 (77%), Positives = 69/79 (87%)
Frame = -3

Query: 239 KDGRKLFVIERDITEPDRIVGELLQPGGYLKLLELDLADCVEDIDAQRVLGYALFKAVRN 60
KDGR++ VIERD+TEPDRIVGELLQPGGYLKL+EL L DCVE+IDAQRVLGYAL K RN
Sbjct: 77 KDGRRVHVIERDMTEPDRIVGELLQPGGYLKLMELGLEDCVEEIDAQRVLGYALLKDGRN 136

Query: 59 TKVRYPLKGYDGDVAGRSF 3
TK+ YPL+ + DVAGRSF
Sbjct: 137 TKLSYPLEKFHSDVAGRSF 155


>tr|Q10PK6|Q10PK6_ORYSJ Squalene monooxygenase, putative, expressed
OS=Oryza sativa subsp. japonica GN=LOC_Os03g12900 PE=4
SV=1
Length = 582

Score = 125 bits (315), Expect = 8e-28
Identities = 61/79 (77%), Positives = 69/79 (87%)
Frame = -3

Query: 239 KDGRKLFVIERDITEPDRIVGELLQPGGYLKLLELDLADCVEDIDAQRVLGYALFKAVRN 60
KDGR++ VIERD+TEPDRIVGELLQPGGYLKL+EL L DCVE+IDAQRVLGYAL K RN
Sbjct: 77 KDGRRVHVIERDMTEPDRIVGELLQPGGYLKLMELGLEDCVEEIDAQRVLGYALLKDGRN 136

Query: 59 TKVRYPLKGYDGDVAGRSF 3
TK+ YPL+ + DVAGRSF
Sbjct: 137 TKLSYPLEKFHSDVAGRSF 155


>tr|Q10PK5|Q10PK5_ORYSJ Os03g0231700 protein OS=Oryza sativa subsp.
japonica GN=Os03g0231700 PE=2 SV=1
Length = 524

Score = 125 bits (315), Expect = 8e-28
Identities = 61/79 (77%), Positives = 69/79 (87%)
Frame = -3

Query: 239 KDGRKLFVIERDITEPDRIVGELLQPGGYLKLLELDLADCVEDIDAQRVLGYALFKAVRN 60
KDGR++ VIERD+TEPDRIVGELLQPGGYLKL+EL L DCVE+IDAQRVLGYAL K RN
Sbjct: 77 KDGRRVHVIERDMTEPDRIVGELLQPGGYLKLMELGLEDCVEEIDAQRVLGYALLKDGRN 136

Query: 59 TKVRYPLKGYDGDVAGRSF 3
TK+ YPL+ + DVAGRSF
Sbjct: 137 TKLSYPLEKFHSDVAGRSF 155