BP916256
Clone id YMU001_000085_C04
Library
Length 410
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000085_C04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GTGGTGGTGGAGGTAATATCTAGTTTTCTTATACTCTTTCTTTGCATCTGCTTAAAGTTC
CATAGTGACATGTCAATAACTGCTATCTTCATTGTAAGACAAAGAAGCCGTTCCTGCATT
GTGCTAGCTGACTGCTTTTATTACATGTAGGAACTTCCTCAGTGTCCTGAGAAGTGTAAT
TTTAGGATATTTTGAACATTGAGTGAGGTTGTGGTATTGTTGCAACCGAAAAGCAAGGGA
GGCGAAGACCTCTTGTACAAAGTCTCCTGGCAATGGACACAAACATGCCCAGTCGAAGAC
CTGCGTTTGTGAAACTTTCACTTGGAGGGCGTTTACATAACACATCAGGTTATGGACTCT
CTGGCCAGCCTAGAGAAAGGATCAATCACACATAGTCTTACTCTTCACCC
■■Homology search results ■■ -
sp_hit_id P17976
Definition sp|P17976|PSIA2_ECOLX Protein psiA OS=Escherichia coli
Align length 23
Score (bit) 30.4
E-value 2.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916256|Adiantum capillus-veneris mRNA, clone:
YMU001_000085_C04.
(410 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P17976|PSIA2_ECOLX Protein psiA OS=Escherichia coli GN=psiA P... 30 2.9
sp|P18148|PSIA1_ECOLI Protein psiA OS=Escherichia coli (strain K... 30 2.9
sp|A4WCV7|MNMC_ENT38 tRNA 5-methylaminomethyl-2-thiouridine bios... 29 8.5

>sp|P17976|PSIA2_ECOLX Protein psiA OS=Escherichia coli GN=psiA PE=4
SV=1
Length = 239

Score = 30.4 bits (67), Expect = 2.9
Identities = 11/23 (47%), Positives = 17/23 (73%)
Frame = -3

Query: 285 CLCPLPGDFVQEVFASLAFRLQQ 217
CL PLPGD + +F S+ FR+++
Sbjct: 93 CLLPLPGDAAERLFPSVRFRVRE 115


>sp|P18148|PSIA1_ECOLI Protein psiA OS=Escherichia coli (strain K12)
GN=psiA PE=4 SV=1
Length = 239

Score = 30.4 bits (67), Expect = 2.9
Identities = 11/23 (47%), Positives = 17/23 (73%)
Frame = -3

Query: 285 CLCPLPGDFVQEVFASLAFRLQQ 217
CL PLPGD + +F S+ FR+++
Sbjct: 93 CLLPLPGDAAERLFPSVRFRVRE 115


>sp|A4WCV7|MNMC_ENT38 tRNA 5-methylaminomethyl-2-thiouridine
biosynthesis bifunctional protein mnmC OS=Enterobacter
sp. (strain 638) GN=mnmC PE=3 SV=2
Length = 666

Score = 28.9 bits (63), Expect = 8.5
Identities = 13/42 (30%), Positives = 23/42 (54%)
Frame = +3

Query: 237 GRRRPLVQSLLAMDTNMPSRRPAFVKLSLGGRLHNTSGYGLS 362
GR+R ++ ++A D +P+R P F + L R G G++
Sbjct: 234 GRKREMLTGVMAQDNALPARAPWFARSGLENRETAIIGGGIA 275


tr_hit_id Q2HUL4
Definition tr|Q2HUL4|Q2HUL4_MEDTR Short-chain dehydrogenase/reductase SDR OS=Medicago truncatula
Align length 34
Score (bit) 33.9
E-value 4.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916256|Adiantum capillus-veneris mRNA, clone:
YMU001_000085_C04.
(410 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q2HUL4|Q2HUL4_MEDTR Short-chain dehydrogenase/reductase SDR O... 34 4.2
tr|A9PCT9|A9PCT9_POPTR Putative uncharacterized protein OS=Popul... 33 7.1

>tr|Q2HUL4|Q2HUL4_MEDTR Short-chain dehydrogenase/reductase SDR
OS=Medicago truncatula GN=MtrDRAFT_AC149131g5v2 PE=3
SV=1
Length = 301

Score = 33.9 bits (76), Expect = 4.2
Identities = 14/34 (41%), Positives = 21/34 (61%)
Frame = -2

Query: 289 GMFVSIARRLCTRGLRLPCFSVATIPQPHSMFKI 188
G+ S+A LC G+R+ C S IP P S+++I
Sbjct: 195 GVVKSVASELCGAGIRVNCISPTAIPTPMSLYQI 228


>tr|A9PCT9|A9PCT9_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 295

Score = 33.1 bits (74), Expect = 7.1
Identities = 16/46 (34%), Positives = 24/46 (52%)
Frame = -2

Query: 289 GMFVSIARRLCTRGLRLPCFSVATIPQPHSMFKIS*NYTSQDTEEV 152
G+ S+A LC G+R+ C S IP P M ++ Y D E++
Sbjct: 192 GIVKSLAAELCKHGIRINCISPFAIPTPFVMEEMRQIYPGADDEKL 237