BP916261
Clone id YMU001_000085_C10
Library
Length 278
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000085_C10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AAGTGGAAGAATTCGCGGCCGCAGGAATGTATATTTGTGACAGAAGTACTCCCTATGCTC
TGTATACCTCTCCGCAATACTCCCAGAAAAATTTGAACTCCAAAAAGAGATTCCAAACAC
AAATTTTGGTTCTTTCCTACTTAGCGTATTCTACTTTCTGATGAGCCTATCAGCTAACAA
GACATTCATAAGATGCTCTAGATCAACAATCATGATATCCTACTTACCCTACTCCTACTC
ATCATGTGAGATGGTGATTTTCAGTGCTTCGGTTGCTT
■■Homology search results ■■ -
sp_hit_id Q66HB5
Definition sp|Q66HB5|RS10B_RAT Radial spoke head 10 homolog B OS=Rattus norvegicus
Align length 28
Score (bit) 29.6
E-value 4.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916261|Adiantum capillus-veneris mRNA, clone:
YMU001_000085_C10.
(250 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q66HB5|RS10B_RAT Radial spoke head 10 homolog B OS=Rattus nor... 30 4.9

>sp|Q66HB5|RS10B_RAT Radial spoke head 10 homolog B OS=Rattus
norvegicus GN=Rsph10b PE=2 SV=1
Length = 876

Score = 29.6 bits (65), Expect = 4.9
Identities = 15/28 (53%), Positives = 18/28 (64%)
Frame = +3

Query: 15 EVLPMLCIPLRNTPRKI*TPKRDSKHKF 98
EV P IP+ TP K TPKRDS+H +
Sbjct: 39 EVAPSAVIPVLETPLKQ-TPKRDSEHTY 65


tr_hit_id A6S4A8
Definition tr|A6S4A8|A6S4A8_BOTFB Putative uncharacterized protein OS=Botryotinia fuckeliana (strain B05.10)
Align length 53
Score (bit) 33.5
E-value 5.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916261|Adiantum capillus-veneris mRNA, clone:
YMU001_000085_C10.
(250 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A6S4A8|A6S4A8_BOTFB Putative uncharacterized protein OS=Botry... 33 5.5
tr|A7PAD1|A7PAD1_VITVI Chromosome chr14 scaffold_9, whole genome... 33 9.4

>tr|A6S4A8|A6S4A8_BOTFB Putative uncharacterized protein
OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_07423
PE=4 SV=1
Length = 684

Score = 33.5 bits (75), Expect = 5.5
Identities = 17/53 (32%), Positives = 29/53 (54%)
Frame = +1

Query: 82 IPNTNFGSFLLSVFYFLMSLSANKTFIRCSRSTIMISYLPYSYSSCEMVIFSA 240
IPNT +G+ S FYF ++ SAN + R+ + +Y+ SY + + + A
Sbjct: 204 IPNTEYGTDEASKFYFPLARSANSSQYTIGRAFLQEAYIITSYETNQFSLHQA 256


>tr|A7PAD1|A7PAD1_VITVI Chromosome chr14 scaffold_9, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00038065001
PE=4 SV=1
Length = 460

Score = 32.7 bits (73), Expect = 9.4
Identities = 13/46 (28%), Positives = 28/46 (60%)
Frame = +1

Query: 106 FLLSVFYFLMSLSANKTFIRCSRSTIMISYLPYSYSSCEMVIFSAS 243
F++S F+FLM S + S+++I +++P SC + +++A+
Sbjct: 3 FVISAFFFLMMFSYTGELLDGSQASIRFNFVPLVQFSCSVFVYAAA 48