BP916282
Clone id YMU001_000085_H01
Library
Length 124
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000085_H01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GGAGGATATGGAGGAGATTGTCACTATACTATAGAGGCCCATGAGACAGTTCATTAGATG
ATCTCCTCCCATCTCAGGCTTACTTCTTATTTCAATCAATGCGGTCTTACCTACCCACCC
ACCA
■■Homology search results ■■ -
sp_hit_id Q1LTV8
Definition sp|Q1LTV8|MNME_BAUCH tRNA modification GTPase mnmE OS=Baumannia cicadellinicola subsp. Homalodisca coagulata
Align length 36
Score (bit) 30.0
E-value 3.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916282|Adiantum capillus-veneris mRNA, clone:
YMU001_000085_H01.
(124 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q1LTV8|MNME_BAUCH tRNA modification GTPase mnmE OS=Baumannia ... 30 3.8

>sp|Q1LTV8|MNME_BAUCH tRNA modification GTPase mnmE OS=Baumannia
cicadellinicola subsp. Homalodisca coagulata GN=mnmE
PE=3 SV=1
Length = 457

Score = 30.0 bits (66), Expect = 3.8
Identities = 14/36 (38%), Positives = 24/36 (66%)
Frame = -2

Query: 108 KTALIEIRSKPEMGGDHLMNCLMGLYSIVTISSISS 1
KT + IR+K ++ G+ + L YS++TIS++SS
Sbjct: 330 KTPVTIIRNKADITGEKIGETLNNNYSVITISALSS 365


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916282|Adiantum capillus-veneris mRNA, clone:
YMU001_000085_H01.
(124 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******