BP916327
Clone id YMU001_000086_D10
Library
Length 361
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000086_D10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CCAAGATATATCCAGAACCTCCAAGAACGGATAACGACTATGTACACTATACAGCAAGCA
GCTTTTTTATGGCTAGCCTCCTGGAGTCAAAGGGATAGCTCCAATCTAGCGGTATTACAT
TCCACCTTGCATCCGAATGCTAGATAAACTGGGCATATTGTCCCTTCCCATGAAAAACAG
TCAGACCTCGATATAAACCCTCACTAGCAGCGCATATGGTAAGCCCAAAAGTCTCGTCCT
TGTCACCATGAGCAAGAAAACCTGTAAAGGAATCAACAAGGCCCGAACTACACTCCATTA
TGCGTGTATTTTCCTTATGAGCATACGTGGTAGCCACTTGAGCCTCCAAAAGACTATCAA
G
■■Homology search results ■■ -
sp_hit_id Q3A4F1
Definition sp|Q3A4F1|MUTS_PELCD DNA mismatch repair protein mutS OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1)
Align length 54
Score (bit) 30.0
E-value 3.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916327|Adiantum capillus-veneris mRNA, clone:
YMU001_000086_D10.
(361 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q3A4F1|MUTS_PELCD DNA mismatch repair protein mutS OS=Pelobac... 30 3.8
sp|A6UN66|ARGJ_METVS Arginine biosynthesis bifunctional protein ... 30 4.9
sp|Q9NB71|HIW_DROME E3 ubiquitin-protein ligase highwire OS=Dros... 29 6.4
sp|Q3E9N1|PP359_ARATH Pentatricopeptide repeat-containing protei... 29 6.5

>sp|Q3A4F1|MUTS_PELCD DNA mismatch repair protein mutS OS=Pelobacter
carbinolicus (strain DSM 2380 / Gra Bd 1) GN=mutS PE=3
SV=1
Length = 870

Score = 30.0 bits (66), Expect = 3.8
Identities = 18/54 (33%), Positives = 27/54 (50%)
Frame = +2

Query: 197 TLTSSAYGKPKSLVLVTMSKKTCKGINKARTTLHYACIFLMSIRGSHLSLQKTI 358
T T G+ SL+ V T G K R +H+ + L +IR HLS+Q+ +
Sbjct: 280 TATLQDGGRKGSLLGVLDRTVTAMGGRKIRQWIHHPLVDLKAIRDRHLSVQELV 333


>sp|A6UN66|ARGJ_METVS Arginine biosynthesis bifunctional protein
argJ OS=Methanococcus vannielii (strain SB / ATCC 35089
/ DSM 1224) GN=argJ PE=3 SV=1
Length = 408

Score = 29.6 bits (65), Expect = 4.9
Identities = 16/36 (44%), Positives = 24/36 (66%)
Frame = -1

Query: 313 ENTRIMECSSGLVDSFTGFLAHGDKDETFGLTICAA 206
EN RI++ G V + GF+A+G KD +G+TI A+
Sbjct: 3 ENFRIID---GGVTAPKGFIANGHKDRKYGVTIIAS 35


>sp|Q9NB71|HIW_DROME E3 ubiquitin-protein ligase highwire
OS=Drosophila melanogaster GN=hiw PE=1 SV=2
Length = 5233

Score = 29.3 bits (64), Expect = 6.4
Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 2/62 (3%)
Frame = +2

Query: 113 YYIPPCIRMLDKLGILSLPMKNSQTSI*T--LTSSAYGKPKSLVLVTMSKKTCKGINKAR 286
Y I C+R+L K I P +NS TS+ T +++A+G +VT +K NK +
Sbjct: 1659 YVIKSCLRLLRKYTIEIYPQRNSSTSVATGGGSNAAHGSG----VVTTAKSVQSKPNKDK 1714

Query: 287 TT 292
T
Sbjct: 1715 NT 1716


>sp|Q3E9N1|PP359_ARATH Pentatricopeptide repeat-containing protein
At4g39952, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E98 PE=2 SV=2
Length = 775

Score = 29.3 bits (64), Expect = 6.5
Identities = 16/47 (34%), Positives = 25/47 (53%)
Frame = -3

Query: 200 GFISRSDCFSWEGTICPVYLAFGCKVECNTARLELSL*LQEASHKKA 60
GF+ R CFS + T+C L+ CK E + +L + E +K+A
Sbjct: 355 GFVIRH-CFSLDSTVCNSLLSMYCKFELLSVAEKLFCRISEEGNKEA 400


tr_hit_id B2GLW9
Definition tr|B2GLW9|B2GLW9_KOCRD Diaminopimelate decarboxylase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 12708 / DC2201)
Align length 58
Score (bit) 33.9
E-value 4.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916327|Adiantum capillus-veneris mRNA, clone:
YMU001_000086_D10.
(361 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B2GLW9|B2GLW9_KOCRD Diaminopimelate decarboxylase OS=Kocuria ... 34 4.2
tr|B2WD63|B2WD63_PYRTR Predicted protein OS=Pyrenophora tritici-... 33 9.4

>tr|B2GLW9|B2GLW9_KOCRD Diaminopimelate decarboxylase OS=Kocuria
rhizophila (strain ATCC 9341 / DSM 348 / NBRC 12708 /
DC2201) GN=lysA PE=4 SV=1
Length = 483

Score = 33.9 bits (76), Expect = 4.2
Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 3/58 (5%)
Frame = -1

Query: 361 LDSLLEAQVATTYAHKENTR---IMECSSGLVDSFTGFLAHGDKDETFGLTICAASEG 197
+DSL E ++ T A + TR ++ + G+ S F+A +D+ FGL++ AA++G
Sbjct: 161 VDSLPEVELLATLARQRGTRAPVMLRVTPGVHASTHEFIATAHEDQKFGLSLHAAADG 218


>tr|B2WD63|B2WD63_PYRTR Predicted protein OS=Pyrenophora
tritici-repentis (strain Pt-1C-BFP) GN=PTRG_07922 PE=4
SV=1
Length = 222

Score = 32.7 bits (73), Expect = 9.4
Identities = 16/32 (50%), Positives = 21/32 (65%)
Frame = +3

Query: 189 RYKPSLAAHMVSPKVSSLSP*ARKPVKESTRP 284
R KPS AAH++SPK ++ + RKP S RP
Sbjct: 192 RTKPSAAAHVLSPKTNAAN--VRKPTARSARP 221