BP916330
Clone id YMU001_000086_E01
Library
Length 369
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000086_E01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ACTATGGACCTGCTTGATTTCACGTCTCATGCGGATCATACCTCTAGACCGGGACATTAC
ACCATCTTCTGGGAACTCAAGAGTACCGCTTGCATTGATGATTCTATTTTGAAACAGTGC
TGCCAGGATCTGGATGCCTCCTTCAATGACCCGTACCAACGTGGGAGAGCTGCTGGAACT
ATAGGGCCCCTTGAGCTTTGTCTTGTGAAGGAACAGACATTTCAGAGTATTATGGATTAT
GTGCTGGAATCTGGAGCTTCTCCTACTCAGTATAAGACCCCTAGGTGCATAAGCTCAGTA
GATTTGTTGAAAATCTTAAGACTTTCTGTTTGTAGTATCTACATCAGCTCACATCGGGGG
GTGTTCTAT
■■Homology search results ■■ -
sp_hit_id O81829
Definition sp|O81829|GH35_ARATH Indole-3-acetic acid-amido synthetase GH3.5 OS=Arabidopsis thaliana
Align length 116
Score (bit) 100.0
E-value 2.0e-21
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916330|Adiantum capillus-veneris mRNA, clone:
YMU001_000086_E01.
(369 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O81829|GH35_ARATH Indole-3-acetic acid-amido synthetase GH3.5... 100 2e-21
sp|Q9LSQ4|GH36_ARATH Indole-3-acetic acid-amido synthetase GH3.6... 100 3e-21
sp|Q8LQM5|GH31_ORYSJ Probable indole-3-acetic acid-amido synthet... 99 9e-21
sp|O22190|GH33_ARATH Indole-3-acetic acid-amido synthetase GH3.3... 98 1e-20
sp|P0C0M3|GH311_ORYSJ Probable indole-3-acetic acid-amido synthe... 97 2e-20
sp|Q9LQ68|GH34_ARATH Indole-3-acetic acid-amido synthetase GH3.4... 97 3e-20
sp|Q60EJ6|GH34_ORYSJ Probable indole-3-acetic acid-amido synthet... 92 1e-18
sp|P0C0M2|GH32_ORYSJ Probable indole-3-acetic acid-amido synthet... 92 1e-18
sp|Q9FZ87|GH317_ARATH Indole-3-acetic acid-amido synthetase GH3.... 91 1e-18
sp|Q0D4Z6|GH38_ORYSJ Probable indole-3-acetic acid-amido synthet... 90 3e-18
sp|A3BLS0|GH38_ORYSI Probable indole-3-acetic acid-amido synthet... 90 3e-18
sp|Q6I581|GH35_ORYSJ Probable indole-3-acetic acid-amido synthet... 89 7e-18
sp|O82333|GH31_ARATH Probable indole-3-acetic acid-amido synthet... 89 7e-18
sp|Q53P49|GH312_ORYSJ Probable indole-3-acetic acid-amido synthe... 87 3e-17
sp|Q6ZLA3|GH39_ORYSJ Probable indole-3-acetic acid-amido synthet... 80 2e-15
sp|O82243|GH39_ARATH Putative indole-3-acetic acid-amido synthet... 80 2e-15
sp|Q654M1|GH37_ORYSJ Probable indole-3-acetic acid-amido synthet... 80 3e-15
sp|Q9SZT9|GH32_ARATH Indole-3-acetic acid-amido synthetase GH3.2... 55 1e-07
sp|Q60EY1|GH36_ORYSJ Probable indole-3-acetic acid-amido synthet... 48 1e-05
sp|Q8C3S2|TMCO7_MOUSE Transmembrane and coiled-coil domain-conta... 31 1.7
sp|Q7N139|MRAW_PHOLL S-adenosyl-L-methionine-dependent methyltra... 30 3.7
sp|P0C6F6|R1A_BC512 Replicase polyprotein 1a OS=Bat coronavirus ... 30 4.9
sp|P0C6W0|R1AB_BC512 Replicase polyprotein 1ab OS=Bat coronaviru... 30 4.9
sp|Q9VZD8|THUM1_DROME THUMP domain-containing protein 1 homolog ... 29 6.4
sp|P24414|NS3B_CVPRM Non-structural protein 3b OS=Porcine respir... 29 6.4
sp|P22656|NS3B_CVPFS Non-structural protein 3b OS=Porcine transm... 29 6.4
sp|P09047|NS3B_CVPPU Putative non-structural protein 3b OS=Porci... 29 8.3

>sp|O81829|GH35_ARATH Indole-3-acetic acid-amido synthetase GH3.5
OS=Arabidopsis thaliana GN=GH3.5 PE=1 SV=1
Length = 612

Score = 100 bits (249), Expect = 2e-21
Identities = 49/116 (42%), Positives = 72/116 (62%), Gaps = 3/116 (2%)
Frame = +1

Query: 10 LLDFTSHADHTSRPGHYTIFWEL--KSTACIDDSILKQCCQDLDASFNDPYQRGRAAG-T 180
L ++TS+AD +S PGHY +FWEL I S+ + CC ++ SFN Y++GR + +
Sbjct: 481 LSEYTSYADTSSIPGHYVLFWELCLDGNTPIPPSVFEDCCLAVEESFNTVYRQGRVSDKS 540

Query: 181 IGPLELCLVKEQTFQSIMDYVLESGASPTQYKTPRCISSVDLLKILRLSVCSIYIS 348
IGPLE+ +V+ TF +MDY + GAS QYKTPRC+ ++++L V Y S
Sbjct: 541 IGPLEIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVDSYFS 596


>sp|Q9LSQ4|GH36_ARATH Indole-3-acetic acid-amido synthetase GH3.6
OS=Arabidopsis thaliana GN=GH3.6 PE=1 SV=1
Length = 612

Score = 100 bits (248), Expect = 3e-21
Identities = 48/116 (41%), Positives = 71/116 (61%), Gaps = 3/116 (2%)
Frame = +1

Query: 10 LLDFTSHADHTSRPGHYTIFWEL--KSTACIDDSILKQCCQDLDASFNDPYQRGRAAG-T 180
L ++TS+AD +S PGHY +FWEL I S+ + CC ++ S N Y++GR + +
Sbjct: 481 LSEYTSYADTSSIPGHYVLFWELCLNGNTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKS 540

Query: 181 IGPLELCLVKEQTFQSIMDYVLESGASPTQYKTPRCISSVDLLKILRLSVCSIYIS 348
IGPLE+ +V+ TF +MDY + GAS QYKTPRC+ ++++L V Y S
Sbjct: 541 IGPLEIKMVESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVDSYFS 596


>sp|Q8LQM5|GH31_ORYSJ Probable indole-3-acetic acid-amido synthetase
GH3.1 OS=Oryza sativa subsp. japonica GN=GH3.1 PE=2 SV=1
Length = 610

Score = 98.6 bits (244), Expect = 9e-21
Identities = 46/115 (40%), Positives = 74/115 (64%), Gaps = 2/115 (1%)
Frame = +1

Query: 10 LLDFTSHADHTSRPGHYTIFWELKS-TACIDDSILKQCCQDLDASFNDPYQRGRAAG-TI 183
L+++TS+AD + PGHY +FWEL++ + + S+ ++CC ++ + N Y++GRA +I
Sbjct: 471 LVEYTSYADAATIPGHYVLFWELRAGSTAVPASVFEECCLSVEEALNSVYRQGRACDRSI 530

Query: 184 GPLELCLVKEQTFQSIMDYVLESGASPTQYKTPRCISSVDLLKILRLSVCSIYIS 348
GPLE+ +V E TF +MDY + GAS QYK PRC+ ++++L V Y S
Sbjct: 531 GPLEIRVVAEGTFDKLMDYAISRGASINQYKAPRCVRPGPVVELLDARVQGKYFS 585


>sp|O22190|GH33_ARATH Indole-3-acetic acid-amido synthetase GH3.3
OS=Arabidopsis thaliana GN=GH3.3 PE=1 SV=1
Length = 595

Score = 97.8 bits (242), Expect = 1e-20
Identities = 46/117 (39%), Positives = 75/117 (64%), Gaps = 4/117 (3%)
Frame = +1

Query: 10 LLDFTSHADHTSRPGHYTIFWEL---KSTACIDDSILKQCCQDLDASFNDPYQRGRAAG- 177
++++TS+A+ + PGHY I+WEL T +D ++ +CC +++ S N Y++ R A
Sbjct: 467 VIEYTSYAETKTIPGHYVIYWELLVKDQTNPPNDEVMARCCLEMEESLNSVYRQSRVADK 526

Query: 178 TIGPLELCLVKEQTFQSIMDYVLESGASPTQYKTPRCISSVDLLKILRLSVCSIYIS 348
+IGPLE+ +VK TF+ +MDY + GAS QYK PRC+S ++++L V S + S
Sbjct: 527 SIGPLEIRVVKNGTFEELMDYAISRGASINQYKVPRCVSFTPIMELLDSRVVSTHFS 583


>sp|P0C0M3|GH311_ORYSJ Probable indole-3-acetic acid-amido
synthetase GH3.11 OS=Oryza sativa subsp. japonica
GN=GH3.11 PE=2 SV=1
Length = 591

Score = 97.1 bits (240), Expect = 2e-20
Identities = 51/119 (42%), Positives = 76/119 (63%), Gaps = 6/119 (5%)
Frame = +1

Query: 10 LLDFTSHADHTSRPGHYTIFWELKST-----ACIDDSILKQCCQDLDASFNDPYQRGRAA 174
LL++TS+ D ++ PGHY +FWE+KST A +D +L+ CC ++ S + Y+R RA
Sbjct: 465 LLEYTSYTDISTVPGHYVLFWEIKSTHDERPAPLDAQLLESCCAAVEESLDYVYRRCRAH 524

Query: 175 G-TIGPLELCLVKEQTFQSIMDYVLESGASPTQYKTPRCISSVDLLKILRLSVCSIYIS 348
+IGPLE+ LV+ F ++MD ++ G+S QYKTPRCI S LK+L V + + S
Sbjct: 525 DRSIGPLEIRLVEAGAFDALMDLLVSHGSSINQYKTPRCIESSLALKLLNSKVIACFFS 583


>sp|Q9LQ68|GH34_ARATH Indole-3-acetic acid-amido synthetase GH3.4
OS=Arabidopsis thaliana GN=GH3.4 PE=1 SV=1
Length = 597

Score = 96.7 bits (239), Expect = 3e-20
Identities = 45/118 (38%), Positives = 76/118 (64%), Gaps = 5/118 (4%)
Frame = +1

Query: 10 LLDFTSHADHTSRPGHYTIFWEL----KSTACIDDSILKQCCQDLDASFNDPYQRGRAAG 177
++++TS+AD + PGHY I+WEL +S A D ++ +CC +++ S N Y++ R +
Sbjct: 468 VIEYTSYADTKTIPGHYVIYWELLSRDQSNALPSDEVMAKCCLEMEESLNAVYRQSRVSD 527

Query: 178 -TIGPLELCLVKEQTFQSIMDYVLESGASPTQYKTPRCISSVDLLKILRLSVCSIYIS 348
+IGPLE+ +V+ TF+ +MD+ + G+S QYK PRC+S ++K+L V S + S
Sbjct: 528 KSIGPLEIRVVQNGTFEELMDFSISRGSSINQYKVPRCVSLTPIMKLLDSRVVSAHFS 585


>sp|Q60EJ6|GH34_ORYSJ Probable indole-3-acetic acid-amido synthetase
GH3.4 OS=Oryza sativa subsp. japonica GN=GH3.4 PE=2 SV=1
Length = 629

Score = 91.7 bits (226), Expect = 1e-18
Identities = 49/118 (41%), Positives = 74/118 (62%), Gaps = 5/118 (4%)
Frame = +1

Query: 10 LLDFTSHADH-TSRPGHYTIFWELKSTAC---IDDSILKQCCQDLDASFNDPYQRGRAAG 177
L+++TS+AD T+ PGHY +FWEL+S A + S+ + CC ++ N Y++ RAA
Sbjct: 479 LVEYTSYADTATTIPGHYVLFWELRSPAGGTPVPASVFEDCCLAVEEGLNSVYRQCRAAD 538

Query: 178 -TIGPLELCLVKEQTFQSIMDYVLESGASPTQYKTPRCISSVDLLKILRLSVCSIYIS 348
+IGPLE+ +V + TF +MDY L GAS QYK PRC+ ++++L V + Y S
Sbjct: 539 RSIGPLEIRVVADGTFDKLMDYALSRGASINQYKAPRCVRPGPVVELLDGRVQATYFS 596


>sp|P0C0M2|GH32_ORYSJ Probable indole-3-acetic acid-amido synthetase
GH3.2 OS=Oryza sativa subsp. japonica GN=GH3.2 PE=2 SV=1
Length = 614

Score = 91.7 bits (226), Expect = 1e-18
Identities = 43/122 (35%), Positives = 71/122 (58%), Gaps = 9/122 (7%)
Frame = +1

Query: 10 LLDFTSHADHTSRPGHYTIFWELK---------STACIDDSILKQCCQDLDASFNDPYQR 162
++++TS AD T+ PGHY ++WEL + ++CC +++ + N Y++
Sbjct: 482 IVEYTSQADATTIPGHYVVYWELMVREGGAWPPPAEEEGRGVFERCCLEMEEALNAVYRQ 541

Query: 163 GRAAGTIGPLELCLVKEQTFQSIMDYVLESGASPTQYKTPRCISSVDLLKILRLSVCSIY 342
GR IGPLE+ +V+ TF+ +MDY + GAS QYK PRC+S ++++L V S +
Sbjct: 542 GRNGEAIGPLEIRVVRAGTFEEVMDYAISRGASINQYKAPRCVSFGPIIELLNSRVISKH 601

Query: 343 IS 348
S
Sbjct: 602 FS 603


>sp|Q9FZ87|GH317_ARATH Indole-3-acetic acid-amido synthetase GH3.17
OS=Arabidopsis thaliana GN=GH3.17 PE=1 SV=1
Length = 609

Score = 91.3 bits (225), Expect = 1e-18
Identities = 48/119 (40%), Positives = 71/119 (59%), Gaps = 6/119 (5%)
Frame = +1

Query: 10 LLDFTSHADHTSRPGHYTIFWELKSTAC-----IDDSILKQCCQDLDASFNDPYQRGRAA 174
L ++TS+AD +S PGHY +FWELK +DD ++ CC +++ + Y+R R
Sbjct: 478 LTEYTSYADTSSIPGHYVLFWELKPRHSNDPPKLDDKTMEDCCSEVEDCLDYVYRRCRNR 537

Query: 175 G-TIGPLELCLVKEQTFQSIMDYVLESGASPTQYKTPRCISSVDLLKILRLSVCSIYIS 348
+IGPLE+ +V TF S+MD+ + G+S QYKTPRC+ S L+IL V + S
Sbjct: 538 DKSIGPLEIRVVSLGTFDSLMDFCVSQGSSLNQYKTPRCVKSGGALEILDSRVIGRFFS 596


>sp|Q0D4Z6|GH38_ORYSJ Probable indole-3-acetic acid-amido synthetase
GH3.8 OS=Oryza sativa subsp. japonica GN=GH3.8 PE=2 SV=1
Length = 605

Score = 90.1 bits (222), Expect = 3e-18
Identities = 44/118 (37%), Positives = 72/118 (61%), Gaps = 5/118 (4%)
Frame = +1

Query: 10 LLDFTSHADHTSRPGHYTIFWELKSTAC----IDDSILKQCCQDLDASFNDPYQRGRAA- 174
++++TS A PGHY I+WEL + +D L +CC +++ + N Y++ R A
Sbjct: 475 VVEYTSQACTKRIPGHYVIYWELLTKGAGATVVDADTLGRCCLEMEEALNTVYRQSRVAD 534

Query: 175 GTIGPLELCLVKEQTFQSIMDYVLESGASPTQYKTPRCISSVDLLKILRLSVCSIYIS 348
G+IGPLE+ +V+ TF+ +MDY + GAS QYK PRC++ ++++L V S + S
Sbjct: 535 GSIGPLEIRVVRPGTFEELMDYAISRGASINQYKVPRCVTFPPIVELLDSRVVSSHFS 592


tr_hit_id Q948Q3
Definition tr|Q948Q3|Q948Q3_PHYPA GH3-like protein 1 (GH3-like protein) OS=Physcomitrella patens
Align length 107
Score (bit) 114.0
E-value 2.0e-24
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916330|Adiantum capillus-veneris mRNA, clone:
YMU001_000086_E01.
(369 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q948Q3|Q948Q3_PHYPA GH3-like protein 1 (GH3-like protein) OS=... 114 2e-24
tr|A9SDD8|A9SDD8_PHYPA Predicted protein OS=Physcomitrella paten... 114 2e-24
tr|A7PXD9|A7PXD9_VITVI Chromosome chr12 scaffold_36, whole genom... 112 1e-23
tr|A9PGW8|A9PGW8_POPTR Putative uncharacterized protein OS=Popul... 110 5e-23
tr|Q70ZZ8|Q70ZZ8_PHYPA GH3-like protein OS=Physcomitrella patens... 107 3e-22
tr|A9TUB3|A9TUB3_PHYPA Predicted protein OS=Physcomitrella paten... 107 3e-22
tr|A2Q639|A2Q639_MEDTR GH3 auxin-responsive promoter OS=Medicago... 103 6e-21
tr|A7PLK7|A7PLK7_VITVI Chromosome chr7 scaffold_20, whole genome... 102 9e-21
tr|A5C238|A5C238_VITVI Putative uncharacterized protein OS=Vitis... 102 9e-21
tr|A7P139|A7P139_VITVI Chromosome chr19 scaffold_4, whole genome... 101 2e-20
tr|A5BXN9|A5BXN9_VITVI Putative uncharacterized protein OS=Vitis... 101 2e-20
tr|Q0GUM1|Q0GUM1_ARATH Auxin-responsive GH3-like OS=Arabidopsis ... 100 4e-20
tr|B5X4Z8|B5X4Z8_ARATH At5g54510 OS=Arabidopsis thaliana PE=2 SV=1 100 5e-20
tr|A7PXP4|A7PXP4_VITVI Chromosome chr12 scaffold_36, whole genom... 100 6e-20
tr|A7QW67|A7QW67_VITVI Chromosome chr3 scaffold_199, whole genom... 99 1e-19
tr|A7QT99|A7QT99_VITVI Chromosome chr1 scaffold_166, whole genom... 99 1e-19
tr|A5APU4|A5APU4_VITVI Putative uncharacterized protein OS=Vitis... 99 1e-19
tr|Q9XEY0|Q9XEY0_TOBAC Nt-gh3 deduced protein OS=Nicotiana tabac... 99 1e-19
tr|Q9FHN7|Q9FHN7_ARATH Auxin-responsive GH3-like protein (Auxin-... 99 1e-19
tr|Q0JIP7|Q0JIP7_ORYSJ cDNA clone:001-114-D12, full insert seque... 99 1e-19
tr|Q6QUQ3|Q6QUQ3_CAPCH Auxin and ethylene responsive GH3-like pr... 98 2e-19
tr|A1BNG5|A1BNG5_9SOLA Jasmonic acid-amino acid-conjugating enzy... 98 2e-19
tr|Q05680|Q05680_SOYBN Auxin-responsive GH3 product OS=Glycine m... 97 4e-19
tr|B8B5U4|B8B5U4_ORYSI Putative uncharacterized protein OS=Oryza... 97 4e-19
tr|A3BNA5|A3BNA5_ORYSJ Putative uncharacterized protein OS=Oryza... 97 4e-19
tr|A2TD22|A2TD22_9MAGN GH3 protein (Fragment) OS=Rhodiola sachal... 97 4e-19
tr|B6EBQ2|B6EBQ2_MAIZE Indole-3-acetic acid amido synthetase OS=... 97 5e-19
tr|Q9C735|Q9C735_ARATH Nt-gh3 deduced protein, putative OS=Arabi... 96 9e-19
tr|B4FEJ3|B4FEJ3_MAIZE Putative uncharacterized protein OS=Zea m... 96 9e-19
tr|Q9LYU4|Q9LYU4_ARATH Auxin-responsive-like protein (Auxin-resp... 96 1e-18

>tr|Q948Q3|Q948Q3_PHYPA GH3-like protein 1 (GH3-like protein)
OS=Physcomitrella patens GN=PpGH3L1 PE=2 SV=1
Length = 599

Score = 114 bits (285), Expect = 2e-24
Identities = 54/107 (50%), Positives = 73/107 (68%), Gaps = 1/107 (0%)
Frame = +1

Query: 4 MDLLDFTSHADHTSRPGHYTIFWELKSTACIDDSILKQCCQDLDASFNDPYQRGRAAGTI 183
M+L D++S+ D S+PGHY IFWEL+S +D +L +CC+ LD SFN+PY RGRAA TI
Sbjct: 465 MELADYSSYTDQDSQPGHYVIFWELRSHEHLDMDLLSECCKVLDQSFNNPYMRGRAARTI 524

Query: 184 GPLELCLVKEQTFQSIMD-YVLESGASPTQYKTPRCISSVDLLKILR 321
GPLEL +VKE F +M+ +V ++G +QYK RC + LK R
Sbjct: 525 GPLELAIVKEGAFARLMEQFVRKNGVGASQYKVSRCFKNPATLKHFR 571


>tr|A9SDD8|A9SDD8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_106250 PE=4 SV=1
Length = 599

Score = 114 bits (285), Expect = 2e-24
Identities = 54/107 (50%), Positives = 73/107 (68%), Gaps = 1/107 (0%)
Frame = +1

Query: 4 MDLLDFTSHADHTSRPGHYTIFWELKSTACIDDSILKQCCQDLDASFNDPYQRGRAAGTI 183
M+L D++S+ D S+PGHY IFWEL+S +D +L +CC+ LD SFN+PY RGRAA TI
Sbjct: 465 MELADYSSYTDQDSQPGHYVIFWELRSHEHLDMDLLSECCKVLDQSFNNPYMRGRAARTI 524

Query: 184 GPLELCLVKEQTFQSIMD-YVLESGASPTQYKTPRCISSVDLLKILR 321
GPLEL +VKE F +M+ +V ++G +QYK RC + LK R
Sbjct: 525 GPLELAIVKEGAFARLMEQFVRKNGVGASQYKVSRCFKNPATLKHFR 571


>tr|A7PXD9|A7PXD9_VITVI Chromosome chr12 scaffold_36, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00026000001
PE=4 SV=1
Length = 592

Score = 112 bits (279), Expect = 1e-23
Identities = 55/112 (49%), Positives = 78/112 (69%), Gaps = 1/112 (0%)
Frame = +1

Query: 7 DLLDFTSHADHTSRPGHYTIFWELKSTACIDDSILKQCCQDLDASFNDP-YQRGRAAGTI 183
+L+DFTSHAD +PGHY I+WE+K A DD +L +CC ++DA F D Y R +I
Sbjct: 476 ELVDFTSHADLVKQPGHYIIYWEIKGEA--DDKVLSECCNEMDACFVDQGYIVSRKTHSI 533

Query: 184 GPLELCLVKEQTFQSIMDYVLESGASPTQYKTPRCISSVDLLKILRLSVCSI 339
GPLELC+V+ TF+ I+D+ + GA+ +Q+KTPRC + LL+I L+VC+I
Sbjct: 534 GPLELCIVERGTFKKILDHFIGKGAALSQFKTPRCTADEVLLRI--LNVCTI 583


>tr|A9PGW8|A9PGW8_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 595

Score = 110 bits (274), Expect = 5e-23
Identities = 52/105 (49%), Positives = 77/105 (73%), Gaps = 1/105 (0%)
Frame = +1

Query: 7 DLLDFTSHADHTSRPGHYTIFWELKSTACIDDSILKQCCQDLDASFNDP-YQRGRAAGTI 183
+L+DFTSHA+ ++PGHY I+WE+K +++ +L +CC+ +DASF D Y R +I
Sbjct: 479 ELVDFTSHAELETQPGHYIIYWEIKGD--VEEEVLGECCKKMDASFVDHGYVVSRRTKSI 536

Query: 184 GPLELCLVKEQTFQSIMDYVLESGASPTQYKTPRCISSVDLLKIL 318
GPLELC+VK TF+ I++Y + +GA+ +Q+KTPRC S+ LLKIL
Sbjct: 537 GPLELCIVKTGTFKKILEYFIGNGAALSQFKTPRCTSNHGLLKIL 581


>tr|Q70ZZ8|Q70ZZ8_PHYPA GH3-like protein OS=Physcomitrella patens
GN=GH3-1 PE=2 SV=1
Length = 636

Score = 107 bits (267), Expect = 3e-22
Identities = 50/105 (47%), Positives = 71/105 (67%)
Frame = +1

Query: 4 MDLLDFTSHADHTSRPGHYTIFWELKSTACIDDSILKQCCQDLDASFNDPYQRGRAAGTI 183
M+L D+TS AD ++ PG Y IFWE+ ++ +D +L+ C LDA+FN Y+R R+ I
Sbjct: 508 MELSDYTSTADVSTLPGRYVIFWEMVDSSDLDYDVLQHCANTLDANFNSDYRRWRSGHQI 567

Query: 184 GPLELCLVKEQTFQSIMDYVLESGASPTQYKTPRCISSVDLLKIL 318
GPLEL +VKE TF +MD + GASP+QYK PRC+++ +IL
Sbjct: 568 GPLELRIVKEGTFNRVMDSAVARGASPSQYKPPRCVNNPHTRQIL 612


>tr|A9TUB3|A9TUB3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_225552 PE=4 SV=1
Length = 636

Score = 107 bits (267), Expect = 3e-22
Identities = 50/105 (47%), Positives = 71/105 (67%)
Frame = +1

Query: 4 MDLLDFTSHADHTSRPGHYTIFWELKSTACIDDSILKQCCQDLDASFNDPYQRGRAAGTI 183
M+L D+TS AD ++ PG Y IFWE+ ++ +D +L+ C LDA+FN Y+R R+ I
Sbjct: 508 MELSDYTSTADVSTLPGRYVIFWEMVDSSDLDYDVLQHCANTLDANFNSDYRRWRSGHQI 567

Query: 184 GPLELCLVKEQTFQSIMDYVLESGASPTQYKTPRCISSVDLLKIL 318
GPLEL +VKE TF +MD + GASP+QYK PRC+++ +IL
Sbjct: 568 GPLELRIVKEGTFNRVMDSAVARGASPSQYKPPRCVNNPHTRQIL 612


>tr|A2Q639|A2Q639_MEDTR GH3 auxin-responsive promoter OS=Medicago
truncatula GN=MtrDRAFT_AC172744g19v1 PE=4 SV=1
Length = 607

Score = 103 bits (256), Expect = 6e-21
Identities = 48/117 (41%), Positives = 76/117 (64%), Gaps = 3/117 (2%)
Frame = +1

Query: 7 DLLDFTSHADHTSRPGHYTIFWEL--KSTACIDDSILKQCCQDLDASFNDPYQRGRAAG- 177
D+ ++TS+AD T+ PGHY ++WEL K + I S+ + CC ++ S N Y++GR +
Sbjct: 475 DVAEYTSYADTTTIPGHYVLYWELNLKGSTKIPHSVYEDCCLTIEESLNSVYRQGRVSDK 534

Query: 178 TIGPLELCLVKEQTFQSIMDYVLESGASPTQYKTPRCISSVDLLKILRLSVCSIYIS 348
+IGPLE+ +V++ TF +MDY + GAS QYKTPRC+ ++++L V + Y S
Sbjct: 535 SIGPLEIKIVEQGTFDKLMDYAINLGASINQYKTPRCVKFAPMVELLESRVMAKYFS 591


>tr|A7PLK7|A7PLK7_VITVI Chromosome chr7 scaffold_20, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00019610001
PE=4 SV=1
Length = 600

Score = 102 bits (254), Expect = 9e-21
Identities = 50/117 (42%), Positives = 75/117 (64%), Gaps = 4/117 (3%)
Frame = +1

Query: 10 LLDFTSHADHTSRPGHYTIFWEL---KSTACIDDSILKQCCQDLDASFNDPYQRGRAA-G 177
++++TS AD + PGHY I+WEL + D++LKQCC ++ S N Y++GR A
Sbjct: 470 VVEYTSFADTKTIPGHYVIYWELLVKDPSNSPTDTVLKQCCLAMEESLNTVYRQGRVADN 529

Query: 178 TIGPLELCLVKEQTFQSIMDYVLESGASPTQYKTPRCISSVDLLKILRLSVCSIYIS 348
+IGPLE+ +VK TF+ +MDY + GAS QYK PRC++ ++++L V S Y S
Sbjct: 530 SIGPLEIRVVKSGTFEELMDYAISRGASINQYKVPRCVNFTPIMELLDSRVLSTYFS 586


>tr|A5C238|A5C238_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_042944 PE=4 SV=1
Length = 607

Score = 102 bits (254), Expect = 9e-21
Identities = 50/117 (42%), Positives = 75/117 (64%), Gaps = 4/117 (3%)
Frame = +1

Query: 10 LLDFTSHADHTSRPGHYTIFWEL---KSTACIDDSILKQCCQDLDASFNDPYQRGRAA-G 177
++++TS AD + PGHY I+WEL + D++LKQCC ++ S N Y++GR A
Sbjct: 470 VVEYTSFADTKTIPGHYVIYWELLVKDPSNSPTDTVLKQCCLAMEESLNTVYRQGRVADN 529

Query: 178 TIGPLELCLVKEQTFQSIMDYVLESGASPTQYKTPRCISSVDLLKILRLSVCSIYIS 348
+IGPLE+ +VK TF+ +MDY + GAS QYK PRC++ ++++L V S Y S
Sbjct: 530 SIGPLEIRVVKSGTFEELMDYAISRGASINQYKVPRCVNFTPIMELLDSRVLSTYFS 586


>tr|A7P139|A7P139_VITVI Chromosome chr19 scaffold_4, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00027472001
PE=4 SV=1
Length = 605

Score = 101 bits (252), Expect = 2e-20
Identities = 48/116 (41%), Positives = 74/116 (63%), Gaps = 3/116 (2%)
Frame = +1

Query: 10 LLDFTSHADHTSRPGHYTIFWEL--KSTACIDDSILKQCCQDLDASFNDPYQRGRAAG-T 180
L ++TS+AD T+ PGHY ++WEL + + I S+ + CC ++ S N Y++GR + +
Sbjct: 473 LTEYTSYADTTTIPGHYVLYWELSLRGSTPIPPSVFEDCCLTVEESLNSVYRQGRVSDKS 532

Query: 181 IGPLELCLVKEQTFQSIMDYVLESGASPTQYKTPRCISSVDLLKILRLSVCSIYIS 348
IGPLE+ +V+ TF +MDY + GAS QYKTPRC+ ++++L V S Y S
Sbjct: 533 IGPLEMKIVESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVSNYFS 588