BP916336
Clone id YMU001_000086_E08
Library
Length 286
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000086_E08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCAGTGATGGTGACAATTTGAGTCACAGTTTTGCAGAGATGTGCTTCATGCCAATTTCAG
ACATCTACTCTCGACGTACAAATTTGTTTAGTGTAAAGATGGCTTCTCCGACAGTTGGCA
TTGATTTAGAGTTATGCCCATGGGATTACAGGCAGGTCGACGACACTGGAAGCGCTGATA
CCACTACTTAAGGTTGATGTCTGCAGTACTGCATACAAATCATTAGGTTGCGAATTTTCA
GACTTTGGAAGATGAGTTCTGATGTTTGCTGGGGCATTTCGTACTT
■■Homology search results ■■ -
sp_hit_id Q68LP1
Definition sp|Q68LP1|MIB2_RAT E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus
Align length 24
Score (bit) 29.3
E-value 6.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916336|Adiantum capillus-veneris mRNA, clone:
YMU001_000086_E08.
(286 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q68LP1|MIB2_RAT E3 ubiquitin-protein ligase MIB2 OS=Rattus no... 29 6.3
sp|Q8R516|MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus mus... 29 6.3
sp|A6WXL6|ARLY_OCHA4 Argininosuccinate lyase OS=Ochrobactrum ant... 29 8.3
sp|P51450|RORG_MOUSE Nuclear receptor ROR-gamma OS=Mus musculus ... 29 8.3

>sp|Q68LP1|MIB2_RAT E3 ubiquitin-protein ligase MIB2 OS=Rattus
norvegicus GN=Mib2 PE=2 SV=2
Length = 971

Score = 29.3 bits (64), Expect = 6.3
Identities = 11/24 (45%), Positives = 13/24 (54%)
Frame = -2

Query: 171 FQCRRPACNPMGITLNQCQLSEKP 100
FQC AC P G LN C + +P
Sbjct: 939 FQCGHGACAPCGAALNACPICRQP 962


>sp|Q8R516|MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus
GN=Mib2 PE=1 SV=2
Length = 973

Score = 29.3 bits (64), Expect = 6.3
Identities = 11/24 (45%), Positives = 13/24 (54%)
Frame = -2

Query: 171 FQCRRPACNPMGITLNQCQLSEKP 100
FQC AC P G LN C + +P
Sbjct: 941 FQCGHGACAPCGAALNACPICRQP 964


>sp|A6WXL6|ARLY_OCHA4 Argininosuccinate lyase OS=Ochrobactrum
anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168)
GN=argH PE=3 SV=1
Length = 466

Score = 28.9 bits (63), Expect = 8.3
Identities = 23/72 (31%), Positives = 37/72 (51%)
Frame = +1

Query: 10 VTI*VTVLQRCASCQFQTSTLDVQICLV*RWLLRQLALI*SYAHGITGRSTTLEALIPLL 189
+TI V +++ A + T+T D+ WL+R+L L AH +TGR+ AL
Sbjct: 355 LTINVASMKKAAGSGYSTAT-DLA-----DWLVRELGLPFREAHHVTGRAV---ALAESR 405

Query: 190 KVDVCSTAYKSL 225
KVD+ + + L
Sbjct: 406 KVDLAKLSLEEL 417


>sp|P51450|RORG_MOUSE Nuclear receptor ROR-gamma OS=Mus musculus
GN=Rorc PE=2 SV=1
Length = 516

Score = 28.9 bits (63), Expect = 8.3
Identities = 12/26 (46%), Positives = 17/26 (65%)
Frame = +3

Query: 15 NLSHSFAEMCFMPISDIYSRRTNLFS 92
N+ SF E C + + D+ +RTNLFS
Sbjct: 274 NVCKSFRETCQLRLEDLLRQRTNLFS 299


tr_hit_id A6TTP4
Definition tr|A6TTP4|A6TTP4_ALKMQ Putative uncharacterized protein OS=Alkaliphilus metalliredigens (strain QYMF)
Align length 48
Score (bit) 32.7
E-value 9.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916336|Adiantum capillus-veneris mRNA, clone:
YMU001_000086_E08.
(286 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A6TTP4|A6TTP4_ALKMQ Putative uncharacterized protein OS=Alkal... 33 9.3

>tr|A6TTP4|A6TTP4_ALKMQ Putative uncharacterized protein
OS=Alkaliphilus metalliredigens (strain QYMF)
GN=Amet_3434 PE=4 SV=1
Length = 217

Score = 32.7 bits (73), Expect = 9.3
Identities = 17/48 (35%), Positives = 25/48 (52%)
Frame = +1

Query: 61 TSTLDVQICLV*RWLLRQLALI*SYAHGITGRSTTLEALIPLLKVDVC 204
T + D+Q+CLV + +LR L+ SY + TL + P L D C
Sbjct: 169 TISCDIQVCLVAKAILRVQLLVPSYGFCVPAPCVTLPGVCPPLPPDQC 216