BP916385
Clone id YMU001_000087_B04
Library
Length 509
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000087_B04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTGTTTGAGGCAAGCATTGATTGCAAATCTTTAAAGAAATTCATATGATCGATACATCCA
TATGAAAAAGCACAGATCGACCTTAACTATTAGGAGATATATGGCAATTCTAGCTTGGGT
TGTCAAGCTAGATTCGCATACCACACATGGACATGGACAAAAGAATGGTAAGATGGAGAA
GGTAGACAAACGTGCTTTCCAACTACCTAACCTTCTTGCGACCTTTGTTAACCTTCACTG
CATTGGTGAGGTAGTTTGTTCTAAAAACTGCATCATCTTTAATAAATCCCCACCAAAAGT
ATGTGAGAGGAACAGTGACAGCATGCCAGAGGGAATGTGCATCAAAGAGACCCCAGAGAG
GAGGAAAGTCGAATATCTCTAAGAGCATAGCCGCCGCACCACCCAGAACCACAAACCATA
ATTTGAACCTGGCTGGATGATGAACGAACCAGCCCCAGACGGTCCAAATAAGAAGCTGAA
GTACTCCCATGATTAAACAGATCTTCATG
■■Homology search results ■■ -
sp_hit_id Q0VFE3
Definition sp|Q0VFE3|PGAP3_XENTR Post-GPI attachment to proteins factor 3 OS=Xenopus tropicalis
Align length 77
Score (bit) 69.7
E-value 7.0e-12
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916385|Adiantum capillus-veneris mRNA, clone:
YMU001_000087_B04.
(509 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q0VFE3|PGAP3_XENTR Post-GPI attachment to proteins factor 3 O... 70 7e-12
sp|Q68EV0|PGAP3_XENLA Post-GPI attachment to proteins factor 3 O... 66 1e-10
sp|A8WFS8|PGAP3_DANRE Post-GPI attachment to proteins factor 3 O... 64 4e-10
sp|Q9P6N9|PER1_SCHPO Protein PER1 homolog OS=Schizosaccharomyces... 60 5e-09
sp|A7YWP2|PGAP3_BOVIN Post-GPI attachment to proteins factor 3 O... 59 2e-08
sp|A2A559|PGAP3_MOUSE Post-GPI attachment to proteins factor 3 O... 57 5e-08
sp|A2V7M9|PGAP3_CRIGR Post-GPI attachment to proteins factor 3 O... 57 5e-08
sp|Q96FM1|PGAP3_HUMAN Post-GPI attachment to proteins factor 3 O... 55 1e-07
sp|Q7K0P4|PGAP3_DROME Post-GPI attachment to proteins factor 3 O... 54 4e-07
sp|P25625|PER1_YEAST Protein PER1 OS=Saccharomyces cerevisiae GN... 35 0.16
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin typ... 31 2.9
sp|Q8UHH1|KUP1_AGRT5 Probable potassium transport system protein... 31 2.9
sp|Q9GZC8|SID1_CAEEL Systemic RNA interference defective protein... 30 5.0
sp|A4QE56|Y1530_CORGB UPF0059 membrane protein cgR_1530 OS=Coryn... 30 6.6
sp|Q6D029|FRDD_ERWCT Fumarate reductase subunit D OS=Erwinia car... 30 6.6
sp|Q54QD9|CTSB_DICDI Cathepsin B OS=Dictyostelium discoideum GN=... 30 6.6
sp|P38671|RPOM_NEUCR DNA-directed RNA polymerase, mitochondrial ... 30 8.6
sp|Q86Y46|K2C73_HUMAN Keratin, type II cytoskeletal 73 OS=Homo s... 30 8.6

>sp|Q0VFE3|PGAP3_XENTR Post-GPI attachment to proteins factor 3
OS=Xenopus tropicalis GN=perld1 PE=2 SV=1
Length = 316

Score = 69.7 bits (169), Expect = 7e-12
Identities = 32/77 (41%), Positives = 48/77 (62%), Gaps = 2/77 (2%)
Frame = -2

Query: 487 GVLQLLIWTVWGWF--VHHPARFKLWFVVLGGAAAMLLEIFDFPPLWGLFDAHSLWHAVT 314
GVL L+ W W + H P +K VV+ + LLE+ DFPP+ + DAH+LWH T
Sbjct: 227 GVLNLMWWLAWCFRRRFHQPYLWKCVLVVISLQSLALLELLDFPPVMWILDAHALWHFST 286

Query: 313 VPLTYFWWGFIKDDAVF 263
VPL + ++ F+KDD+++
Sbjct: 287 VPLHFLFYSFLKDDSLY 303


>sp|Q68EV0|PGAP3_XENLA Post-GPI attachment to proteins factor 3
OS=Xenopus laevis GN=perld1 PE=2 SV=1
Length = 317

Score = 65.9 bits (159), Expect = 1e-10
Identities = 29/77 (37%), Positives = 49/77 (63%)
Frame = -2

Query: 493 IMGVLQLLIWTVWGWFVHHPARFKLWFVVLGGAAAMLLEIFDFPPLWGLFDAHSLWHAVT 314
I+ ++ L W +W F H P +K VV+ + LLE+ DFPP+ + DAH+LWH T
Sbjct: 228 IVNLMWWLAWCMWRRF-HQPYLWKCVLVVVLLQSLALLELLDFPPVMWILDAHALWHFST 286

Query: 313 VPLTYFWWGFIKDDAVF 263
+PL + ++ F++DD+++
Sbjct: 287 IPLHFLFYSFLRDDSLY 303


>sp|A8WFS8|PGAP3_DANRE Post-GPI attachment to proteins factor 3
OS=Danio rerio GN=perld1 PE=2 SV=1
Length = 316

Score = 63.9 bits (154), Expect = 4e-10
Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 2/81 (2%)
Frame = -2

Query: 490 MGVLQLLIWTVWGWFVHH--PARFKLWFVVLGGAAAMLLEIFDFPPLWGLFDAHSLWHAV 317
+G++ LL W W W P ++ VVL LLE+ DFPPL+ + DAH++WH
Sbjct: 227 IGIINLLWWLCWCWLNRRILPYWWRCGMVVLLLHGLALLELLDFPPLFWVLDAHAVWHLS 286

Query: 316 TVPLTYFWWGFIKDDAVFRTN 254
TVP+ + ++ F+ DD++ N
Sbjct: 287 TVPVHFLFYSFLIDDSLHLLN 307


>sp|Q9P6N9|PER1_SCHPO Protein PER1 homolog OS=Schizosaccharomyces
pombe GN=SPAC823.07 PE=2 SV=1
Length = 331

Score = 60.5 bits (145), Expect = 5e-09
Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 3/79 (3%)
Frame = -2

Query: 508 MKICLIMGVLQLLIWTVWGWFVHHPARF-KLW--FVVLGGAAAMLLEIFDFPPLWGLFDA 338
MK + +G++Q ++W + W + + W ++V A LE+FDF P+ L DA
Sbjct: 231 MKANVAVGLVQNILWYYYSWSNRNSGLYWTRWPAYIVTSLMLATSLELFDFSPIANLIDA 290

Query: 337 HSLWHAVTVPLTYFWWGFI 281
H+LWH TVP+T++ +GF+
Sbjct: 291 HALWHLSTVPITHYLYGFV 309


>sp|A7YWP2|PGAP3_BOVIN Post-GPI attachment to proteins factor 3
OS=Bos taurus GN=PERLD1 PE=2 SV=1
Length = 319

Score = 58.5 bits (140), Expect = 2e-08
Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
Frame = -2

Query: 490 MGVLQLLIWTVWG-WFVHHPARFKLWFVVLGGAAAMLLEIFDFPPLWGLFDAHSLWHAVT 314
+G+L W W W P K VVL LLE+ DFPPL+ + DAH++WH T
Sbjct: 231 IGLLNAAWWLAWCLWNQRLPHVHKCVAVVLLLQGLSLLELLDFPPLFWVLDAHAIWHIST 290

Query: 313 VPLTYFWWGFIKDDAVF 263
+P+ ++ F++DD+++
Sbjct: 291 IPVHVLFFSFLEDDSLY 307


>sp|A2A559|PGAP3_MOUSE Post-GPI attachment to proteins factor 3
OS=Mus musculus GN=Perld1 PE=2 SV=1
Length = 320

Score = 57.0 bits (136), Expect = 5e-08
Identities = 28/80 (35%), Positives = 49/80 (61%), Gaps = 4/80 (5%)
Frame = -2

Query: 490 MGVLQLLIWTVW----GWFVHHPARFKLWFVVLGGAAAMLLEIFDFPPLWGLFDAHSLWH 323
+G++ L W VW + H R + V+L G + LLE+ DFPPL+ + DAH++WH
Sbjct: 231 IGLVNLAWWLVWCLRNRQRLPHTRRCMVVVVLLQGLS--LLELLDFPPLFWVLDAHAIWH 288

Query: 322 AVTVPLTYFWWGFIKDDAVF 263
T+P+ ++ F++DD+++
Sbjct: 289 ISTIPVHTLFFRFLEDDSLY 308


>sp|A2V7M9|PGAP3_CRIGR Post-GPI attachment to proteins factor 3
OS=Cricetulus griseus GN=PERLD1 PE=2 SV=1
Length = 320

Score = 57.0 bits (136), Expect = 5e-08
Identities = 28/78 (35%), Positives = 45/78 (57%), Gaps = 2/78 (2%)
Frame = -2

Query: 490 MGVLQLLIWTVWGWFVHH--PARFKLWFVVLGGAAAMLLEIFDFPPLWGLFDAHSLWHAV 317
+G++ L W W H P K VVL LLE+ DFPPL+ + DAH++WH
Sbjct: 231 IGLVNLAWWLAWCLRNHRRLPHTRKCVAVVLLLQGLSLLELLDFPPLFWVLDAHAIWHIS 290

Query: 316 TVPLTYFWWGFIKDDAVF 263
T+P+ ++ F++DD+++
Sbjct: 291 TIPVHVLFFRFLEDDSLY 308


>sp|Q96FM1|PGAP3_HUMAN Post-GPI attachment to proteins factor 3
OS=Homo sapiens GN=PERLD1 PE=2 SV=2
Length = 320

Score = 55.5 bits (132), Expect = 1e-07
Identities = 26/78 (33%), Positives = 46/78 (58%), Gaps = 2/78 (2%)
Frame = -2

Query: 490 MGVLQLLIWTVWGWFVHH--PARFKLWFVVLGGAAAMLLEIFDFPPLWGLFDAHSLWHAV 317
+G++ ++ W W + P K VVL LLE+ DFPPL+ + DAH++WH
Sbjct: 231 IGLVNVVWWLAWCLWNQRRLPHVRKCVVVVLLLQGLSLLELLDFPPLFWVLDAHAIWHIS 290

Query: 316 TVPLTYFWWGFIKDDAVF 263
T+P+ ++ F++DD+++
Sbjct: 291 TIPVHVLFFSFLEDDSLY 308


>sp|Q7K0P4|PGAP3_DROME Post-GPI attachment to proteins factor 3
OS=Drosophila melanogaster GN=CG3271 PE=1 SV=2
Length = 326

Score = 53.9 bits (128), Expect = 4e-07
Identities = 27/77 (35%), Positives = 44/77 (57%), Gaps = 4/77 (5%)
Frame = -2

Query: 508 MKICLIMGVLQLLIWTVWGWFVH----HPARFKLWFVVLGGAAAMLLEIFDFPPLWGLFD 341
M + + GV+ + W VW FV + R +++++ A AM LE+ DFPP+ + D
Sbjct: 232 MMVNVATGVIAAVGWFVWCHFVRTRRPYFRRILRFYILM--ALAMSLELLDFPPILWILD 289

Query: 340 AHSLWHAVTVPLTYFWW 290
AH+LWH T+PL ++
Sbjct: 290 AHALWHLATIPLASLYY 306


>sp|P25625|PER1_YEAST Protein PER1 OS=Saccharomyces cerevisiae
GN=PER1 PE=1 SV=1
Length = 357

Score = 35.4 bits (80), Expect = 0.16
Identities = 18/53 (33%), Positives = 28/53 (52%)
Frame = -2

Query: 412 VVLGGAAAMLLEIFDFPPLWGLFDAHSLWHAVTVPLTYFWWGFIKDDAVFRTN 254
+V+ AM LE+FDF DAH+LWH T+ ++ + F +D + N
Sbjct: 301 LVIVTTMAMSLELFDFFSYEWQIDAHALWHLCTIWPSWVLYDFFLEDYAYWGN 353


tr_hit_id A5BYH9
Definition tr|A5BYH9|A5BYH9_VITVI Putative uncharacterized protein (Chromosome chr16 scaffold_189, whole genome shotgun sequence) OS=Vitis vinifera
Align length 87
Score (bit) 140.0
E-value 5.0e-32
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916385|Adiantum capillus-veneris mRNA, clone:
YMU001_000087_B04.
(509 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5BYH9|A5BYH9_VITVI Putative uncharacterized protein (Chromos... 140 5e-32
tr|A9SY97|A9SY97_PHYPA Predicted protein OS=Physcomitrella paten... 139 6e-32
tr|Q75G54|Q75G54_ORYSJ Os05g0220100 protein OS=Oryza sativa subs... 135 9e-31
tr|A2Y1P4|A2Y1P4_ORYSI Putative uncharacterized protein OS=Oryza... 135 9e-31
tr|A5BF52|A5BF52_VITVI Putative uncharacterized protein OS=Vitis... 135 1e-30
tr|A7PWQ8|A7PWQ8_VITVI Chromosome chr19 scaffold_35, whole genom... 133 4e-30
tr|A9PK05|A9PK05_POPJC Putative uncharacterized protein OS=Popul... 132 1e-29
tr|Q2XPW8|Q2XPW8_SOLTU Per1-like family protein OS=Solanum tuber... 132 1e-29
tr|Q2V9B6|Q2V9B6_SOLTU Per1-like family protein OS=Solanum tuber... 132 1e-29
tr|B3TPP2|B3TPP2_SOLCO PERLD1 (Fragment) OS=Solanum commersonii ... 132 1e-29
tr|B6SWR1|B6SWR1_MAIZE CAB2 OS=Zea mays PE=2 SV=1 130 4e-29
tr|B3TPN3|B3TPN3_SOYBN PERLD1 OS=Glycine max PE=4 SV=1 123 6e-27
tr|B4FZ25|B4FZ25_MAIZE Putative uncharacterized protein OS=Zea m... 120 4e-26
tr|Q9FX73|Q9FX73_ARATH F19K19.12 protein OS=Arabidopsis thaliana... 120 5e-26
tr|Q2V4M8|Q2V4M8_ARATH Uncharacterized protein At1g16560.4 OS=Ar... 120 5e-26
tr|B7FI27|B7FI27_MEDTR Putative uncharacterized protein OS=Medic... 119 8e-26
tr|B4G0T1|B4G0T1_MAIZE Putative uncharacterized protein OS=Zea m... 99 1e-19
tr|B4FHP1|B4FHP1_MAIZE Putative uncharacterized protein OS=Zea m... 99 1e-19
tr|B4FUL5|B4FUL5_MAIZE Putative uncharacterized protein OS=Zea m... 91 3e-17
tr|A2Z9H6|A2Z9H6_ORYSI Putative uncharacterized protein OS=Oryza... 90 5e-17
tr|Q8H096|Q8H096_ORYSJ Os10g0524100 protein OS=Oryza sativa subs... 90 7e-17
tr|A2Z9H9|A2Z9H9_ORYSI Putative uncharacterized protein OS=Oryza... 90 7e-17
tr|Q9FIS5|Q9FIS5_ARATH Arabidopsis thaliana genomic DNA, chromos... 88 3e-16
tr|Q94EI5|Q94EI5_ARATH AT5g62130/mtg10_150 OS=Arabidopsis thalia... 88 3e-16
tr|A8I9U6|A8I9U6_CHLRE Predicted protein (Fragment) OS=Chlamydom... 79 1e-13
tr|B3S8W2|B3S8W2_TRIAD Putative uncharacterized protein OS=Trich... 73 7e-12
tr|B0D2T1|B0D2T1_LACBS Predicted protein OS=Laccaria bicolor (st... 73 9e-12
tr|B8M6P4|B8M6P4_9EURO Mn2 homeostasis protein (Per1), putative ... 72 2e-11
tr|Q2HED2|Q2HED2_CHAGB Putative uncharacterized protein OS=Chaet... 72 2e-11
tr|B6Q3J5|B6Q3J5_PENMA Mn2+ homeostasis protein (Per1), putative... 72 2e-11

>tr|A5BYH9|A5BYH9_VITVI Putative uncharacterized protein (Chromosome
chr16 scaffold_189, whole genome shotgun sequence)
OS=Vitis vinifera GN=GSVIVT00007415001 PE=4 SV=1
Length = 342

Score = 140 bits (352), Expect = 5e-32
Identities = 55/87 (63%), Positives = 69/87 (79%)
Frame = -2

Query: 508 MKICLIMGVLQLLIWTVWGWFVHHPARFKLWFVVLGGAAAMLLEIFDFPPLWGLFDAHSL 329
MK+CL MG+ QLL+WTVW HHP+R+KLW VV+GGA AM LEI+DFPP WG DAH++
Sbjct: 251 MKVCLTMGIAQLLLWTVWAGVTHHPSRWKLWVVVVGGALAMFLEIYDFPPYWGFVDAHAV 310

Query: 328 WHAVTVPLTYFWWGFIKDDAVFRTNYL 248
WHA+ +P TY WW F+KDD+ FRT+ L
Sbjct: 311 WHALAIPFTYLWWSFVKDDSEFRTSAL 337


>tr|A9SY97|A9SY97_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_167123 PE=4 SV=1
Length = 368

Score = 139 bits (351), Expect = 6e-32
Identities = 56/87 (64%), Positives = 70/87 (80%)
Frame = -2

Query: 508 MKICLIMGVLQLLIWTVWGWFVHHPARFKLWFVVLGGAAAMLLEIFDFPPLWGLFDAHSL 329
M +C+++GV QLLIW+ WG+ HPARFKL VV G A AMLLE+FDFPPLWG+FDAH++
Sbjct: 262 MIVCVVIGVAQLLIWSTWGFITRHPARFKLCTVVFGAAFAMLLEVFDFPPLWGIFDAHAI 321

Query: 328 WHAVTVPLTYFWWGFIKDDAVFRTNYL 248
WH T+P+TY WW FIKDDA++RT L
Sbjct: 322 WHGATLPITYLWWSFIKDDAIYRTEML 348


>tr|Q75G54|Q75G54_ORYSJ Os05g0220100 protein OS=Oryza sativa subsp.
japonica GN=B1003C08.3 PE=2 SV=1
Length = 349

Score = 135 bits (341), Expect = 9e-31
Identities = 57/87 (65%), Positives = 67/87 (77%)
Frame = -2

Query: 508 MKICLIMGVLQLLIWTVWGWFVHHPARFKLWFVVLGGAAAMLLEIFDFPPLWGLFDAHSL 329
MK+C++M V+QLL W +W HP+RFKLW VV GGA AMLLE++DFPP G DAHSL
Sbjct: 258 MKVCVVMAVVQLLAWAIWAGITQHPSRFKLWVVVFGGALAMLLEVYDFPPYKGYADAHSL 317

Query: 328 WHAVTVPLTYFWWGFIKDDAVFRTNYL 248
WHA T+PLTY WW FIKDDA FRT+ L
Sbjct: 318 WHASTIPLTYLWWSFIKDDAEFRTSTL 344


>tr|A2Y1P4|A2Y1P4_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_18926 PE=4 SV=1
Length = 349

Score = 135 bits (341), Expect = 9e-31
Identities = 57/87 (65%), Positives = 67/87 (77%)
Frame = -2

Query: 508 MKICLIMGVLQLLIWTVWGWFVHHPARFKLWFVVLGGAAAMLLEIFDFPPLWGLFDAHSL 329
MK+C++M V+QLL W +W HP+RFKLW VV GGA AMLLE++DFPP G DAHSL
Sbjct: 258 MKVCVVMAVVQLLAWAIWAGITQHPSRFKLWVVVFGGALAMLLEVYDFPPYKGYADAHSL 317

Query: 328 WHAVTVPLTYFWWGFIKDDAVFRTNYL 248
WHA T+PLTY WW FIKDDA FRT+ L
Sbjct: 318 WHASTIPLTYLWWSFIKDDAEFRTSTL 344


>tr|A5BF52|A5BF52_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_034376 PE=4 SV=1
Length = 342

Score = 135 bits (340), Expect = 1e-30
Identities = 56/84 (66%), Positives = 67/84 (79%)
Frame = -2

Query: 508 MKICLIMGVLQLLIWTVWGWFVHHPARFKLWFVVLGGAAAMLLEIFDFPPLWGLFDAHSL 329
MK+C++MGV QLLIWT+W HP+R+KLW VV+GG AMLLEI+DFPP G DAH+L
Sbjct: 251 MKVCVVMGVAQLLIWTIWAGVTRHPSRWKLWTVVVGGGLAMLLEIYDFPPYEGFVDAHAL 310

Query: 328 WHAVTVPLTYFWWGFIKDDAVFRT 257
WHA T+PLTY WW FIKDDA F+T
Sbjct: 311 WHATTIPLTYIWWSFIKDDAEFQT 334


>tr|A7PWQ8|A7PWQ8_VITVI Chromosome chr19 scaffold_35, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00025726001
PE=4 SV=1
Length = 331

Score = 133 bits (335), Expect = 4e-30
Identities = 55/84 (65%), Positives = 66/84 (78%)
Frame = -2

Query: 508 MKICLIMGVLQLLIWTVWGWFVHHPARFKLWFVVLGGAAAMLLEIFDFPPLWGLFDAHSL 329
MK+C++MGV QLLIW +W HP+R+KLW VV+GG AMLLEI+DFPP G DAH+L
Sbjct: 240 MKVCVVMGVAQLLIWAIWAGVTRHPSRWKLWTVVVGGGLAMLLEIYDFPPYEGFVDAHAL 299

Query: 328 WHAVTVPLTYFWWGFIKDDAVFRT 257
WHA T+PLTY WW FIKDDA F+T
Sbjct: 300 WHATTIPLTYIWWSFIKDDAEFQT 323


>tr|A9PK05|A9PK05_POPJC Putative uncharacterized protein OS=Populus
jackii PE=2 SV=1
Length = 348

Score = 132 bits (332), Expect = 1e-29
Identities = 55/87 (63%), Positives = 66/87 (75%)
Frame = -2

Query: 508 MKICLIMGVLQLLIWTVWGWFVHHPARFKLWFVVLGGAAAMLLEIFDFPPLWGLFDAHSL 329
MK+C+ MGV QLLIW VW +HP+R KLW V+GG A+LLEI+DFPP G DAH+L
Sbjct: 257 MKVCVAMGVAQLLIWAVWAGVTNHPSRLKLWVAVVGGGLAILLEIYDFPPYQGFVDAHAL 316

Query: 328 WHAVTVPLTYFWWGFIKDDAVFRTNYL 248
WHA T+PLTY WW F+KDDA FRT+ L
Sbjct: 317 WHATTIPLTYLWWSFVKDDAEFRTSSL 343


>tr|Q2XPW8|Q2XPW8_SOLTU Per1-like family protein OS=Solanum
tuberosum PE=2 SV=1
Length = 342

Score = 132 bits (331), Expect = 1e-29
Identities = 54/87 (62%), Positives = 67/87 (77%)
Frame = -2

Query: 508 MKICLIMGVLQLLIWTVWGWFVHHPARFKLWFVVLGGAAAMLLEIFDFPPLWGLFDAHSL 329
MK+CL MG+LQL++W VW HP+R+KLW VV+GGA A LLEI+DFPP G DAH+L
Sbjct: 251 MKVCLGMGILQLILWAVWAGVTRHPSRWKLWVVVIGGALAALLEIYDFPPYRGFVDAHAL 310

Query: 328 WHAVTVPLTYFWWGFIKDDAVFRTNYL 248
WHA T+PLTY WW F++DD+ FRT L
Sbjct: 311 WHATTIPLTYLWWSFVRDDSEFRTTTL 337


>tr|Q2V9B6|Q2V9B6_SOLTU Per1-like family protein OS=Solanum
tuberosum PE=2 SV=1
Length = 342

Score = 132 bits (331), Expect = 1e-29
Identities = 54/87 (62%), Positives = 67/87 (77%)
Frame = -2

Query: 508 MKICLIMGVLQLLIWTVWGWFVHHPARFKLWFVVLGGAAAMLLEIFDFPPLWGLFDAHSL 329
MK+CL MG+LQL++W VW HP+R+KLW VV+GGA A LLEI+DFPP G DAH+L
Sbjct: 251 MKVCLGMGILQLILWAVWAGVTRHPSRWKLWVVVIGGALAALLEIYDFPPYRGFVDAHAL 310

Query: 328 WHAVTVPLTYFWWGFIKDDAVFRTNYL 248
WHA T+PLTY WW F++DD+ FRT L
Sbjct: 311 WHATTIPLTYLWWSFVRDDSEFRTTTL 337


>tr|B3TPP2|B3TPP2_SOLCO PERLD1 (Fragment) OS=Solanum commersonii
PE=4 SV=1
Length = 307

Score = 132 bits (331), Expect = 1e-29
Identities = 54/87 (62%), Positives = 67/87 (77%)
Frame = -2

Query: 508 MKICLIMGVLQLLIWTVWGWFVHHPARFKLWFVVLGGAAAMLLEIFDFPPLWGLFDAHSL 329
MK+CL MG+LQL++W VW HP+R+KLW VV+GGA A LLEI+DFPP G DAH+L
Sbjct: 216 MKVCLGMGILQLILWAVWAGVTRHPSRWKLWVVVIGGALAALLEIYDFPPYRGFVDAHAL 275

Query: 328 WHAVTVPLTYFWWGFIKDDAVFRTNYL 248
WHA T+PLTY WW F++DD+ FRT L
Sbjct: 276 WHATTIPLTYLWWNFVRDDSEFRTTTL 302