BP916396
Clone id YMU001_000087_C03
Library
Length 591
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000087_C03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTCCTAGCTCTCTCGGCGTCAGACCTCCTAATACCTGATGATTCCTGTGTCTTCCTCTCT
TTTCCCAGCTCAATAAAAGAGCAAATCAATCAACCTTCCTGTTCGGGCATGACTTCAAGC
TTAACCAGGCTTGCATCATCAATCTGCAAGGCCAATCGAGCGGTCTCATAACACACAAAG
GAAATCCCAGCAGCAGGAATAAGTTTTAACCAGGTTGTTCCAAGTCCCTTGTACAGAGCC
AGAAACCCTTCATGCTGATAAATATCCAAAATGACCCCAACAGTCGATTTCTTAACAAAA
GCCCCTGTAAGAGACAACTGCATTTGCCTTCTTGCCACCTCTAATGGATAAGTAACAGCA
CTAGAAGCAGCCGCTGCCACAGCGCCAAACACAAGGGTTGCCTCTGTTGGAACATTATTC
TTCCCCGTGGAACGACGATAAGCTGTGCGAAGCCCATCATACACAAAGTAATTGGTTGCA
GCATAAGGGAACACTCCCACAAGGCTGGGACTCAAACCTGAATAAAATGCCAAGAACCCC
TCATCTTGAGCTATCTTCCTGATCGCTTGTGACAGGCTACTATACAGCGAG
■■Homology search results ■■ -
sp_hit_id P29518
Definition sp|P29518|BT1_MAIZE Protein brittle-1, chloroplastic/amyloplastic OS=Zea mays
Align length 151
Score (bit) 119.0
E-value 1.0e-26
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916396|Adiantum capillus-veneris mRNA, clone:
YMU001_000087_C03.
(591 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P29518|BT1_MAIZE Protein brittle-1, chloroplastic/amyloplasti... 119 1e-26
sp|Q5PQ27|S2542_XENLA Solute carrier family 25 member 42 OS=Xeno... 96 2e-19
sp|Q0P483|S2542_DANRE Solute carrier family 25 member 42 OS=Dani... 93 9e-19
sp|Q05AQ3|S2542_XENTR Solute carrier family 25 member 42 OS=Xeno... 91 6e-18
sp|P0C546|S2542_RAT Solute carrier family 25 member 42 OS=Rattus... 90 1e-17
sp|Q8R0Y8|S2542_MOUSE Solute carrier family 25 member 42 OS=Mus ... 90 1e-17
sp|Q86VD7|S2542_HUMAN Solute carrier family 25 member 42 OS=Homo... 89 1e-17
sp|Q7T0U6|SCM1B_XENLA Calcium-binding mitochondrial carrier prot... 86 1e-16
sp|Q7ZY36|SCM1A_XENLA Calcium-binding mitochondrial carrier prot... 84 5e-16
sp|Q5XHA0|SCMC1_XENTR Calcium-binding mitochondrial carrier prot... 83 9e-16
sp|Q8BMD8|SCMC1_MOUSE Calcium-binding mitochondrial carrier prot... 83 9e-16
sp|O18757|SCMC1_RABIT Calcium-binding mitochondrial carrier prot... 82 3e-15
sp|A2CEQ0|SCM2B_DANRE Calcium-binding mitochondrial carrier prot... 81 3e-15
sp|Q0V7M4|SCMC2_BOVIN Calcium-binding mitochondrial carrier prot... 81 4e-15
sp|A5PJZ1|SCMC1_BOVIN Calcium-binding mitochondrial carrier prot... 80 8e-15
sp|Q8N5S1|S2541_HUMAN Solute carrier family 25 member 41 OS=Homo... 80 1e-14
sp|Q6NUK1|SCMC1_HUMAN Calcium-binding mitochondrial carrier prot... 79 1e-14
sp|Q66L49|SCMC1_DANRE Calcium-binding mitochondrial carrier prot... 79 1e-14
sp|Q7ZYD5|SCMC2_XENLA Calcium-binding mitochondrial carrier prot... 79 2e-14
sp|Q628Z2|CMC3_CAEBR Probable calcium-binding mitochondrial carr... 79 2e-14
sp|Q5XH95|SCMC2_XENTR Calcium-binding mitochondrial carrier prot... 79 2e-14
sp|Q6KCM7|SCMC2_HUMAN Calcium-binding mitochondrial carrier prot... 79 2e-14
sp|Q19529|CMC3_CAEEL Probable calcium-binding mitochondrial carr... 79 2e-14
sp|Q6NYZ6|SCM2A_DANRE Calcium-binding mitochondrial carrier prot... 78 3e-14
sp|A2ASZ8|SCMC2_MOUSE Calcium-binding mitochondrial carrier prot... 78 4e-14
sp|Q8K3P6|SCMC2_RAT Calcium-binding mitochondrial carrier protei... 77 8e-14
sp|Q9BV35|SCMC3_HUMAN Calcium-binding mitochondrial carrier prot... 76 1e-13
sp|Q20799|CMC2_CAEEL Putative calcium-binding mitochondrial carr... 76 1e-13
sp|Q6GQS1|SCMC3_MOUSE Calcium-binding mitochondrial carrier prot... 76 1e-13
sp|O65023|EAAC_ARATH Probable envelope ADP,ATP carrier protein, ... 74 4e-13

>sp|P29518|BT1_MAIZE Protein brittle-1, chloroplastic/amyloplastic
OS=Zea mays GN=BT1 PE=2 SV=1
Length = 436

Score = 119 bits (298), Expect = 1e-26
Identities = 65/151 (43%), Positives = 96/151 (63%), Gaps = 4/151 (2%)
Frame = -2

Query: 587 LYSSLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTGKN--- 417
+Y +++ A KI +DEG Y GL+PSL+GV PYAA N++ Y+ L+ YRR+TG+
Sbjct: 263 VYDNVAHAFVKILRDEGPSELYRGLTPSLIGVVPYAACNFYAYETLKRLYRRATGRRPGA 322

Query: 416 NVPTEATLVFGXXXXXXXXXVTYPLEVARRQMQL-SLTGAFVKKSTVGVILDIYQHEGFL 240
+V ATL+ G T+PLEVAR+QMQ+ ++ G V ++ + I I + EG
Sbjct: 323 DVGPVATLLIGSAAGAIASSATFPLEVARKQMQVGAVGGRQVYQNVLHAIYCILKKEGAG 382

Query: 239 ALYKGLGTTWLKLIPAAGISFVCYETARLAL 147
LY+GLG + +KL+PAAGI+F+CYE + L
Sbjct: 383 GLYRGLGPSCIKLMPAAGIAFMCYEACKKIL 413



Score = 53.1 bits (126), Expect = 1e-06
Identities = 38/145 (26%), Positives = 68/145 (46%), Gaps = 4/145 (2%)
Frame = -2

Query: 578 SLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTGKNN----V 411
S++ + I Q+EG+ + G + +++ V P A +F YD TA + T K + +
Sbjct: 171 SMAGVFQWIMQNEGWTGLFRGNAVNVLRVAPSKAIEHFTYD---TAKKFLTPKGDEPPKI 227

Query: 410 PTEATLVFGXXXXXXXXXVTYPLEVARRQMQLSLTGAFVKKSTVGVILDIYQHEGFLALY 231
P LV G TYP+E+ + ++ + V + + I + EG LY
Sbjct: 228 PIPTPLVAGALAGFASTLCTYPMELIKTRVTIEKD---VYDNVAHAFVKILRDEGPSELY 284

Query: 230 KGLGTTWLKLIPAAGISFVCYETAR 156
+GL + + ++P A +F YET +
Sbjct: 285 RGLTPSLIGVVPYAACNFYAYETLK 309



Score = 41.6 bits (96), Expect = 0.003
Identities = 27/98 (27%), Positives = 41/98 (41%)
Frame = -2

Query: 449 RTAYRRSTGKNNVPTEATLVFGXXXXXXXXXVTYPLEVARRQMQLSLTGAFVKKSTVGVI 270
R+ G++ P A LV G PLE R + + G S GV
Sbjct: 120 RSEPEEGQGQDRQPAPARLVSGAIAGAVSRTFVAPLETIRTHLMVGSIGV---DSMAGVF 176

Query: 269 LDIYQHEGFLALYKGLGTTWLKLIPAAGISFVCYETAR 156
I Q+EG+ L++G L++ P+ I Y+TA+
Sbjct: 177 QWIMQNEGWTGLFRGNAVNVLRVAPSKAIEHFTYDTAK 214


>sp|Q5PQ27|S2542_XENLA Solute carrier family 25 member 42 OS=Xenopus
laevis GN=slc25a42 PE=2 SV=1
Length = 327

Score = 95.5 bits (236), Expect = 2e-19
Identities = 47/149 (31%), Positives = 82/149 (55%), Gaps = 1/149 (0%)
Frame = -2

Query: 587 LYSSLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTGKNNVP 408
+YS++ +++++EG + Y G +P+++GV PYA ++F Y+ L+ + +G+
Sbjct: 169 MYSNIIHVFMRMSREEGLKSLYRGFTPTVLGVIPYAGISFFTYETLKKLHAEHSGRTQPY 228

Query: 407 TEATLVFGXXXXXXXXXVTYPLEVARRQMQLSLTGAFVKKSTVGVILDIYQHEGFL-ALY 231
T L+FG +YPL+V RR+MQ + S +G + +I EGF+ LY
Sbjct: 229 TFERLLFGACAGLFGQSSSYPLDVVRRRMQTAGVTGHTYGSIIGTMQEIVAEEGFIRGLY 288

Query: 230 KGLGTTWLKLIPAAGISFVCYETARLALQ 144
KGL W+K A GISF ++ ++ L+
Sbjct: 289 KGLSMNWVKGPVAVGISFTTFDLTQILLK 317



Score = 62.4 bits (150), Expect = 2e-09
Identities = 44/139 (31%), Positives = 69/139 (49%), Gaps = 3/139 (2%)
Frame = -2

Query: 563 IRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFV---YDGLRTAYRRSTGKNNVPTEATL 393
I + ++GFL+ + G S ++V V PYAA + Y L +Y G P L
Sbjct: 80 IYRTYMNDGFLSLWRGNSATMVRVIPYAAIQFCAHEQYKKLLGSYYGFQGSALTPIPRLL 139

Query: 392 VFGXXXXXXXXXVTYPLEVARRQMQLSLTGAFVKKSTVGVILDIYQHEGFLALYKGLGTT 213
G +TYPL++ R +M ++T + + + V + + + EG +LY+G T
Sbjct: 140 A-GALAGTTATLLTYPLDLVRARM--AVTQKEMYSNIIHVFMRMSREEGLKSLYRGFTPT 196

Query: 212 WLKLIPAAGISFVCYETAR 156
L +IP AGISF YET +
Sbjct: 197 VLGVIPYAGISFFTYETLK 215



Score = 37.7 bits (86), Expect = 0.043
Identities = 24/86 (27%), Positives = 40/86 (46%)
Frame = -2

Query: 422 KNNVPTEATLVFGXXXXXXXXXVTYPLEVARRQMQLSLTGAFVKKSTVGVILDIYQHEGF 243
KN+ +L G PL+ + Q+S + F K +I Y ++GF
Sbjct: 31 KNHKSVLNSLTSGALAGAVAKTAVAPLDRTKIIFQVS-SNRFSAKEAYRLIYRTYMNDGF 89

Query: 242 LALYKGLGTTWLKLIPAAGISFVCYE 165
L+L++G T +++IP A I F +E
Sbjct: 90 LSLWRGNSATMVRVIPYAAIQFCAHE 115


>sp|Q0P483|S2542_DANRE Solute carrier family 25 member 42 OS=Danio
rerio GN=slc25a42 PE=2 SV=1
Length = 321

Score = 93.2 bits (230), Expect = 9e-19
Identities = 47/149 (31%), Positives = 81/149 (54%), Gaps = 1/149 (0%)
Frame = -2

Query: 587 LYSSLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTGKNNVP 408
+YS++ +I+++EG Y G +P+++GV PYA ++F Y+ L+ + TG+ +
Sbjct: 168 MYSNIMDVFVRISREEGLKTLYRGFTPTILGVVPYAGLSFFTYETLKKTHAEKTGRAHPF 227

Query: 407 TEATLVFGXXXXXXXXXVTYPLEVARRQMQLSLTGAFVKKSTVGVILDIYQHEGFL-ALY 231
LVFG +YPL+V RR+MQ + + +G + +I EG + LY
Sbjct: 228 PYERLVFGACAGLIGQSASYPLDVVRRRMQTAGVTGHTYSTVLGTMREIVAEEGIVRGLY 287

Query: 230 KGLGTTWLKLIPAAGISFVCYETARLALQ 144
KGL W+K A GISF+ ++ ++ L+
Sbjct: 288 KGLSMNWVKGPIAVGISFMTFDLTQILLR 316



Score = 63.2 bits (152), Expect = 1e-09
Identities = 42/132 (31%), Positives = 67/132 (50%), Gaps = 3/132 (2%)
Frame = -2

Query: 542 EGFLAFYSGLSPSLVGVFPYAATNYFV---YDGLRTAYRRSTGKNNVPTEATLVFGXXXX 372
+GF + + G S ++V V PYAA + Y G+ Y GK +P L+ G
Sbjct: 86 DGFFSLWRGNSATMVRVIPYAAIQFCAHEQYKGILGKYYGFQGKA-LPPVPRLLAGSLAG 144

Query: 371 XXXXXVTYPLEVARRQMQLSLTGAFVKKSTVGVILDIYQHEGFLALYKGLGTTWLKLIPA 192
+TYPL++ R +M ++T + + + V + I + EG LY+G T L ++P
Sbjct: 145 TTAAIITYPLDMVRARM--AVTPKEMYSNIMDVFVRISREEGLKTLYRGFTPTILGVVPY 202

Query: 191 AGISFVCYETAR 156
AG+SF YET +
Sbjct: 203 AGLSFFTYETLK 214



Score = 34.7 bits (78), Expect = 0.37
Identities = 22/78 (28%), Positives = 36/78 (46%)
Frame = -2

Query: 398 TLVFGXXXXXXXXXVTYPLEVARRQMQLSLTGAFVKKSTVGVILDIYQHEGFLALYKGLG 219
+LV G PL+ + Q+S + F K +I Y +GF +L++G
Sbjct: 38 SLVSGAFAGAVAKTAVAPLDRTKIIFQVS-SNRFSAKEAYRLIYRTYLKDGFFSLWRGNS 96

Query: 218 TTWLKLIPAAGISFVCYE 165
T +++IP A I F +E
Sbjct: 97 ATMVRVIPYAAIQFCAHE 114


>sp|Q05AQ3|S2542_XENTR Solute carrier family 25 member 42 OS=Xenopus
tropicalis GN=slc25a42 PE=2 SV=1
Length = 327

Score = 90.5 bits (223), Expect = 6e-18
Identities = 45/149 (30%), Positives = 80/149 (53%), Gaps = 1/149 (0%)
Frame = -2

Query: 587 LYSSLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTGKNNVP 408
+YS++ +++++EG + Y G +P+++GV PYA ++F Y+ L+ + +G+
Sbjct: 169 MYSNIIHVFMRMSREEGLKSLYRGFTPTVLGVIPYAGISFFTYETLKKLHAEHSGRTQPY 228

Query: 407 TEATLVFGXXXXXXXXXVTYPLEVARRQMQLSLTGAFVKKSTVGVILDIYQHEGFL-ALY 231
L+FG +YPL+V RR+MQ + S +G + +I EG + LY
Sbjct: 229 PFERLLFGACAGLFGQSASYPLDVVRRRMQTAGVTGHAYGSIIGTMQEIVAEEGVIRGLY 288

Query: 230 KGLGTTWLKLIPAAGISFVCYETARLALQ 144
KGL W+K A GISF ++ ++ L+
Sbjct: 289 KGLSMNWVKGPVAVGISFTTFDLTQILLK 317



Score = 63.2 bits (152), Expect = 1e-09
Identities = 44/133 (33%), Positives = 67/133 (50%), Gaps = 3/133 (2%)
Frame = -2

Query: 545 DEGFLAFYSGLSPSLVGVFPYAATNYFV---YDGLRTAYRRSTGKNNVPTEATLVFGXXX 375
+EGFL+ + G S ++V V PYAA + Y L +Y G P L G
Sbjct: 86 NEGFLSLWRGNSATMVRVIPYAAIQFCAHEQYKKLLGSYYGFQGSALTPIPRLLA-GALA 144

Query: 374 XXXXXXVTYPLEVARRQMQLSLTGAFVKKSTVGVILDIYQHEGFLALYKGLGTTWLKLIP 195
+TYPL++ R +M ++T + + + V + + + EG +LY+G T L +IP
Sbjct: 145 GTTATIITYPLDLVRARM--AVTPKEMYSNIIHVFMRMSREEGLKSLYRGFTPTVLGVIP 202

Query: 194 AAGISFVCYETAR 156
AGISF YET +
Sbjct: 203 YAGISFFTYETLK 215



Score = 38.1 bits (87), Expect = 0.033
Identities = 25/86 (29%), Positives = 41/86 (47%)
Frame = -2

Query: 422 KNNVPTEATLVFGXXXXXXXXXVTYPLEVARRQMQLSLTGAFVKKSTVGVILDIYQHEGF 243
KN+ +L+ G PL+ + Q+S + F K +I Y +EGF
Sbjct: 31 KNHKSILNSLMSGALAGAVAKTAVAPLDRTKIIFQVS-SNRFSAKEAYRLIYRTYLNEGF 89

Query: 242 LALYKGLGTTWLKLIPAAGISFVCYE 165
L+L++G T +++IP A I F +E
Sbjct: 90 LSLWRGNSATMVRVIPYAAIQFCAHE 115


>sp|P0C546|S2542_RAT Solute carrier family 25 member 42 OS=Rattus
norvegicus GN=Slc25a42 PE=2 SV=1
Length = 318

Score = 89.7 bits (221), Expect = 1e-17
Identities = 47/149 (31%), Positives = 80/149 (53%), Gaps = 1/149 (0%)
Frame = -2

Query: 587 LYSSLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTGKNNVP 408
+YS++ +I+++EG Y G +P+++GV PYA ++F Y+ L++ +R +G+
Sbjct: 166 MYSNIFHVFIRISREEGLKTLYFGFTPTVLGVIPYAGLSFFTYESLKSLHREYSGRPQPY 225

Query: 407 TEATLVFGXXXXXXXXXVTYPLEVARRQMQLSLTGAFVKKSTVGVILDIYQHEGFL-ALY 231
+VFG +YPL+V RR+MQ + S + + I + EG + LY
Sbjct: 226 PFERMVFGACAGLIGQSASYPLDVVRRRMQTAGVTGHQHGSILSTLRSIVREEGAVRGLY 285

Query: 230 KGLGTTWLKLIPAAGISFVCYETARLALQ 144
KGL WLK A GISF ++ ++ L+
Sbjct: 286 KGLSMNWLKGPIAVGISFTTFDLMQILLR 314



Score = 59.3 bits (142), Expect = 1e-08
Identities = 42/136 (30%), Positives = 67/136 (49%), Gaps = 6/136 (4%)
Frame = -2

Query: 545 DEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTGK------NNVPTEATLVFG 384
+EGFL+ + G S ++V V PYAA + ++ Y+R G +P L+ G
Sbjct: 83 NEGFLSLWRGNSATMVRVIPYAAIQFSAHE----EYKRILGHYYGFRGEALPPWPRLLAG 138

Query: 383 XXXXXXXXXVTYPLEVARRQMQLSLTGAFVKKSTVGVILDIYQHEGFLALYKGLGTTWLK 204
+TYPL++ R +M ++T + + V + I + EG LY G T L
Sbjct: 139 ALAGTTAASLTYPLDLVRARM--AVTPKEMYSNIFHVFIRISREEGLKTLYFGFTPTVLG 196

Query: 203 LIPAAGISFVCYETAR 156
+IP AG+SF YE+ +
Sbjct: 197 VIPYAGLSFFTYESLK 212



Score = 37.4 bits (85), Expect = 0.056
Identities = 25/89 (28%), Positives = 43/89 (48%)
Frame = -2

Query: 431 STGKNNVPTEATLVFGXXXXXXXXXVTYPLEVARRQMQLSLTGAFVKKSTVGVILDIYQH 252
ST N+ ++L+ G PL+ + Q+S + F K ++ Y +
Sbjct: 25 STKANHRQVLSSLLSGALAGALAKTAVAPLDRTKIIFQVS-SKRFSAKEAFRLLYFTYLN 83

Query: 251 EGFLALYKGLGTTWLKLIPAAGISFVCYE 165
EGFL+L++G T +++IP A I F +E
Sbjct: 84 EGFLSLWRGNSATMVRVIPYAAIQFSAHE 112


>sp|Q8R0Y8|S2542_MOUSE Solute carrier family 25 member 42 OS=Mus
musculus GN=Slc25a42 PE=2 SV=1
Length = 318

Score = 89.7 bits (221), Expect = 1e-17
Identities = 47/149 (31%), Positives = 80/149 (53%), Gaps = 1/149 (0%)
Frame = -2

Query: 587 LYSSLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTGKNNVP 408
+YS++ +I+++EG Y G +P+++GV PYA ++F Y+ L++ +R +G+
Sbjct: 166 MYSNIFHVFIRISREEGLKTLYFGFTPTVLGVIPYAGLSFFTYESLKSLHREYSGRPQPY 225

Query: 407 TEATLVFGXXXXXXXXXVTYPLEVARRQMQLSLTGAFVKKSTVGVILDIYQHEGFL-ALY 231
+VFG +YPL+V RR+MQ + S + + I + EG + LY
Sbjct: 226 PFERMVFGACAGLIGQSASYPLDVVRRRMQTAGVTGHQHGSILSTLRSIVREEGAVRGLY 285

Query: 230 KGLGTTWLKLIPAAGISFVCYETARLALQ 144
KGL WLK A GISF ++ ++ L+
Sbjct: 286 KGLSMNWLKGPIAVGISFTTFDLMQILLR 314



Score = 59.3 bits (142), Expect = 1e-08
Identities = 42/136 (30%), Positives = 67/136 (49%), Gaps = 6/136 (4%)
Frame = -2

Query: 545 DEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTGK------NNVPTEATLVFG 384
+EGFL+ + G S ++V V PYAA + ++ Y+R G +P L+ G
Sbjct: 83 NEGFLSLWRGNSATMVRVIPYAAIQFSAHE----EYKRILGHYYGFRGEALPPWPRLLAG 138

Query: 383 XXXXXXXXXVTYPLEVARRQMQLSLTGAFVKKSTVGVILDIYQHEGFLALYKGLGTTWLK 204
+TYPL++ R +M ++T + + V + I + EG LY G T L
Sbjct: 139 ALAGTTAASLTYPLDLVRARM--AVTPKEMYSNIFHVFIRISREEGLKTLYFGFTPTVLG 196

Query: 203 LIPAAGISFVCYETAR 156
+IP AG+SF YE+ +
Sbjct: 197 VIPYAGLSFFTYESLK 212



Score = 35.4 bits (80), Expect = 0.21
Identities = 20/61 (32%), Positives = 34/61 (55%)
Frame = -2

Query: 347 PLEVARRQMQLSLTGAFVKKSTVGVILDIYQHEGFLALYKGLGTTWLKLIPAAGISFVCY 168
PL+ + Q+S + F K ++ Y +EGFL+L++G T +++IP A I F +
Sbjct: 53 PLDRTKIIFQVS-SKRFSAKEAFRLLYFTYLNEGFLSLWRGNSATMVRVIPYAAIQFSAH 111

Query: 167 E 165
E
Sbjct: 112 E 112


>sp|Q86VD7|S2542_HUMAN Solute carrier family 25 member 42 OS=Homo
sapiens GN=SLC25A42 PE=1 SV=2
Length = 318

Score = 89.4 bits (220), Expect = 1e-17
Identities = 45/149 (30%), Positives = 80/149 (53%), Gaps = 1/149 (0%)
Frame = -2

Query: 587 LYSSLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTGKNNVP 408
+YS++ +I+++EG Y G P+++GV PYA ++F Y+ L++ +R +G+
Sbjct: 166 MYSNIFHVFIRISREEGLKTLYHGFMPTVLGVIPYAGLSFFTYETLKSLHREYSGRRQPY 225

Query: 407 TEATLVFGXXXXXXXXXVTYPLEVARRQMQLSLTGAFVKKSTVGVILDIYQHEGFL-ALY 231
++FG +YPL+V RR+MQ + + + S + I + EG + LY
Sbjct: 226 PFERMIFGACAGLIGQSASYPLDVVRRRMQTAGVTGYPRASIARTLRTIVREEGAVRGLY 285

Query: 230 KGLGTTWLKLIPAAGISFVCYETARLALQ 144
KGL W+K A GISF ++ ++ L+
Sbjct: 286 KGLSMNWVKGPIAVGISFTTFDLMQILLR 314



Score = 60.5 bits (145), Expect = 6e-09
Identities = 43/136 (31%), Positives = 66/136 (48%), Gaps = 6/136 (4%)
Frame = -2

Query: 545 DEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTGK------NNVPTEATLVFG 384
+EGFL+ + G S ++V V PYAA + ++ Y+R G +P L G
Sbjct: 83 NEGFLSLWRGNSATMVRVVPYAAIQFSAHE----EYKRILGSYYGFRGEALPPWPRLFAG 138

Query: 383 XXXXXXXXXVTYPLEVARRQMQLSLTGAFVKKSTVGVILDIYQHEGFLALYKGLGTTWLK 204
+TYPL++ R +M ++T + + V + I + EG LY G T L
Sbjct: 139 ALAGTTAASLTYPLDLVRARM--AVTPKEMYSNIFHVFIRISREEGLKTLYHGFMPTVLG 196

Query: 203 LIPAAGISFVCYETAR 156
+IP AG+SF YET +
Sbjct: 197 VIPYAGLSFFTYETLK 212


>sp|Q7T0U6|SCM1B_XENLA Calcium-binding mitochondrial carrier protein
SCaMC-1-B OS=Xenopus laevis GN=slc25a24-B PE=2 SV=1
Length = 473

Score = 86.3 bits (212), Expect = 1e-16
Identities = 52/152 (34%), Positives = 81/152 (53%), Gaps = 4/152 (2%)
Frame = -2

Query: 584 YSSLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTGKN--NV 411
YS + +KI Q EG AFY G P+++G+ PYA + +Y+ L+ + ++ K+ N
Sbjct: 323 YSGMFDCAKKIMQKEGIRAFYKGYIPNILGIIPYAGIDLAIYETLKNYWLQNHAKDSANP 382

Query: 410 PTEATLVFGXXXXXXXXXVTYPLEVARRQM--QLSLTGAFVKKSTVGVILDIYQHEGFLA 237
L G +YPL + R +M Q S+ GA + + G+ I EGFL
Sbjct: 383 GVLVLLGCGTASSTCGQLASYPLALIRTRMQAQASIEGA-PQLNMGGLFRKIVAKEGFLG 441

Query: 236 LYKGLGTTWLKLIPAAGISFVCYETARLALQI 141
LY+G+G +LK++PA IS+V YE ++ L I
Sbjct: 442 LYRGIGPNFLKVLPAVSISYVVYEKMKVQLGI 473


>sp|Q7ZY36|SCM1A_XENLA Calcium-binding mitochondrial carrier protein
SCaMC-1-A OS=Xenopus laevis GN=slc25a24-A PE=2 SV=2
Length = 473

Score = 84.0 bits (206), Expect = 5e-16
Identities = 51/152 (33%), Positives = 79/152 (51%), Gaps = 4/152 (2%)
Frame = -2

Query: 584 YSSLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTGKN--NV 411
YS + +KI Q EG LAFY G P+++G+ PYA + +Y+ L+ + ++ K+ N
Sbjct: 323 YSGMFDCAKKIMQKEGILAFYKGYIPNILGIIPYAGIDLAIYETLKNYWLQNYAKDSANP 382

Query: 410 PTEATLVFGXXXXXXXXXVTYPLEVARRQM--QLSLTGAFVKKSTVGVILDIYQHEGFLA 237
L G +YPL + R +M Q S+ GA + + G+ I EGF
Sbjct: 383 GVLVLLGCGTVSSTCGQLASYPLALIRTRMQAQASIEGA-PQLNMGGLFRKIVAKEGFFG 441

Query: 236 LYKGLGTTWLKLIPAAGISFVCYETARLALQI 141
LY G+ +LK++PA IS+V YE ++ L I
Sbjct: 442 LYTGIAPNFLKVLPAVSISYVVYEKMKIQLGI 473


>sp|Q5XHA0|SCMC1_XENTR Calcium-binding mitochondrial carrier protein
SCaMC-1 OS=Xenopus tropicalis GN=slc25a24 PE=2 SV=1
Length = 473

Score = 83.2 bits (204), Expect = 9e-16
Identities = 51/152 (33%), Positives = 79/152 (51%), Gaps = 4/152 (2%)
Frame = -2

Query: 584 YSSLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRR--STGKNNV 411
YS + +KI Q EG AFY G P+++G+ PYA + +Y+ L+T + + +T N
Sbjct: 323 YSGMFDCAKKIMQREGVRAFYKGYIPNILGIIPYAGIDLAIYETLKTFWLQNYATDSANP 382

Query: 410 PTEATLVFGXXXXXXXXXVTYPLEVARRQM--QLSLTGAFVKKSTVGVILDIYQHEGFLA 237
L G +YPL + R +M Q S+ GA + + G+ I EGF
Sbjct: 383 GVLVLLGCGTASSTCGQLASYPLALIRTRMQAQASIEGA-PQLNMGGLFRKIVAKEGFFG 441

Query: 236 LYKGLGTTWLKLIPAAGISFVCYETARLALQI 141
LY+G+ +LK++PA IS+V YE ++ L I
Sbjct: 442 LYRGIAPNFLKVLPAVSISYVVYEKMKIKLGI 473


tr_hit_id Q9SUV1
Definition tr|Q9SUV1|Q9SUV1_ARATH Adenylate translocator (Brittle-1)-like protein (AT4g32400/F8B4_100) OS=Arabidopsis thaliana
Align length 148
Score (bit) 133.0
E-value 9.0e-30
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916396|Adiantum capillus-veneris mRNA, clone:
YMU001_000087_C03.
(591 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9SUV1|Q9SUV1_ARATH Adenylate translocator (Brittle-1)-like p... 133 9e-30
tr|A9SRD8|A9SRD8_PHYPA Predicted protein OS=Physcomitrella paten... 129 2e-28
tr|Q6E5A5|Q6E5A5_HORVD Plastidial ADP-glucose transporter OS=Hor... 128 2e-28
tr|A7P5R3|A7P5R3_VITVI Chromosome chr4 scaffold_6, whole genome ... 127 5e-28
tr|A5AV90|A5AV90_VITVI Putative uncharacterized protein OS=Vitis... 127 5e-28
tr|Q69XJ8|Q69XJ8_ORYSJ Os06g0602700 protein OS=Oryza sativa subs... 126 8e-28
tr|A2YER7|A2YER7_ORYSI Putative uncharacterized protein OS=Oryza... 126 8e-28
tr|Q9ZNY4|Q9ZNY4_SOLTU Mitochondrial energy transfer protein OS=... 126 1e-27
tr|Q65XR7|Q65XR7_ORYSJ Os05g0171300 protein OS=Oryza sativa subs... 126 1e-27
tr|Q38M74|Q38M74_SOLTU Brittle 1 protein-like OS=Solanum tuberos... 126 1e-27
tr|A2Y0V2|A2Y0V2_ORYSI Putative uncharacterized protein OS=Oryza... 126 1e-27
tr|B2LWG6|B2LWG6_MAIZE Protein brittle-1 OS=Zea mays GN=BT2B PE=... 125 2e-27
tr|B4FQD1|B4FQD1_MAIZE Putative uncharacterized protein OS=Zea m... 125 2e-27
tr|B2LWG5|B2LWG5_MAIZE Nucleotide sugar translocator BT2A OS=Zea... 125 2e-27
tr|B6TVG6|B6TVG6_MAIZE Protein brittle-1 OS=Zea mays PE=2 SV=1 124 3e-27
tr|Q6Z782|Q6Z782_ORYSJ Os02g0202400 protein OS=Oryza sativa subs... 124 5e-27
tr|A2X256|A2X256_ORYSI Putative uncharacterized protein OS=Oryza... 124 5e-27
tr|A5APG4|A5APG4_VITVI Putative uncharacterized protein (Chromos... 122 2e-26
tr|A9T229|A9T229_PHYPA Predicted protein (Fragment) OS=Physcomit... 120 4e-26
tr|B4F832|B4F832_MAIZE Putative uncharacterized protein OS=Zea m... 119 1e-25
tr|A9SAY1|A9SAY1_PHYPA Predicted protein (Fragment) OS=Physcomit... 119 2e-25
tr|A9RQK6|A9RQK6_PHYPA Predicted protein OS=Physcomitrella paten... 115 2e-24
tr|A3A4A0|A3A4A0_ORYSJ Putative uncharacterized protein OS=Oryza... 115 2e-24
tr|A9SQG3|A9SQG3_PHYPA Predicted protein OS=Physcomitrella paten... 105 1e-21
tr|Q9LJX5|Q9LJX5_ARATH Similarity to membrane carrier/translocat... 102 1e-20
tr|Q8LF38|Q8LF38_ARATH Mitochondrial carrier protein, putative O... 102 1e-20
tr|B6TZ69|B6TZ69_MAIZE Protein brittle-1 OS=Zea mays PE=2 SV=1 100 1e-19
tr|A9PI41|A9PI41_POPTR Putative uncharacterized protein OS=Popul... 99 2e-19
tr|B6SS93|B6SS93_MAIZE Putative uncharacterized protein OS=Zea m... 98 3e-19
tr|B4F8N6|B4F8N6_MAIZE Putative uncharacterized protein OS=Zea m... 97 5e-19

>tr|Q9SUV1|Q9SUV1_ARATH Adenylate translocator (Brittle-1)-like
protein (AT4g32400/F8B4_100) OS=Arabidopsis thaliana
GN=F8B4.100 PE=2 SV=1
Length = 392

Score = 133 bits (334), Expect = 9e-30
Identities = 68/148 (45%), Positives = 93/148 (62%), Gaps = 1/148 (0%)
Frame = -2

Query: 587 LYSSLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTGKNNVP 408
+Y + A KI ++EG Y GL+PSL+GV PYAATNYF YD LR AYR + + +
Sbjct: 238 VYKGIFDAFLKIIREEGPTELYRGLAPSLIGVVPYAATNYFAYDSLRKAYRSFSKQEKIG 297

Query: 407 TEATLVFGXXXXXXXXXVTYPLEVARRQMQL-SLTGAFVKKSTVGVILDIYQHEGFLALY 231
TL+ G T+PLEVAR+ MQ+ +++G V K+ + ++ I +HEG L Y
Sbjct: 298 NIETLLIGSLAGALSSTATFPLEVARKHMQVGAVSGRVVYKNMLHALVTILEHEGILGWY 357

Query: 230 KGLGTTWLKLIPAAGISFVCYETARLAL 147
KGLG + LKL+PAAGISF+CYE + L
Sbjct: 358 KGLGPSCLKLVPAAGISFMCYEACKKIL 385



Score = 53.9 bits (128), Expect = 7e-06
Identities = 35/145 (24%), Positives = 68/145 (46%), Gaps = 1/145 (0%)
Frame = -2

Query: 581 SSLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTG-KNNVPT 405
+S ++ I + EG+ + G +++ V P A FV++ + G ++ +P
Sbjct: 145 NSSTEVFSDIMKHEGWTGLFRGNLVNVIRVAPARAVELFVFETVNKKLSPPHGQESKIPI 204

Query: 404 EATLVFGXXXXXXXXXVTYPLEVARRQMQLSLTGAFVKKSTVGVILDIYQHEGFLALYKG 225
A+L+ G +TYPLE+ + ++ + V K L I + EG LY+G
Sbjct: 205 PASLLAGACAGVSQTLLTYPLELVKTRLTIQ---RGVYKGIFDAFLKIIREEGPTELYRG 261

Query: 224 LGTTWLKLIPAAGISFVCYETARLA 150
L + + ++P A ++ Y++ R A
Sbjct: 262 LAPSLIGVVPYAATNYFAYDSLRKA 286



Score = 34.3 bits (77), Expect = 5.4
Identities = 19/67 (28%), Positives = 31/67 (46%)
Frame = -2

Query: 347 PLEVARRQMQLSLTGAFVKKSTVGVILDIYQHEGFLALYKGLGTTWLKLIPAAGISFVCY 168
PLE R + + G S+ V DI +HEG+ L++G +++ PA + +
Sbjct: 130 PLETIRTHLMVGSGG----NSSTEVFSDIMKHEGWTGLFRGNLVNVIRVAPARAVELFVF 185

Query: 167 ETARLAL 147
ET L
Sbjct: 186 ETVNKKL 192


>tr|A9SRD8|A9SRD8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_133855 PE=3 SV=1
Length = 341

Score = 129 bits (323), Expect = 2e-28
Identities = 65/153 (42%), Positives = 95/153 (62%), Gaps = 2/153 (1%)
Frame = -2

Query: 584 YSSLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTGKNNVPT 405
Y + A+ +I +EGFL Y GL+PS++GV PYA NYF YD LR+ Y+R + + +
Sbjct: 187 YRGILHALYRIVTEEGFLELYRGLAPSIIGVIPYAGVNYFAYDSLRSMYKRLSKEERIGN 246

Query: 404 EATLVFGXXXXXXXXXVTYPLEVARRQMQL-SLTGAFVKKSTVGVILDIYQHEGFLALYK 228
TL+ G T+PLEVAR+QMQ+ ++ G V ST+ + I + G LY+
Sbjct: 247 IQTLLIGSLAGAIASSSTFPLEVARKQMQVGAIKGRVVYSSTLDALRGIVKERGISGLYR 306

Query: 227 GLGTTWLKLIPAAGISFVCYET-ARLALQIDDA 132
GLG + LKL+PAAG+SF+CYE R+ L+ ++A
Sbjct: 307 GLGPSCLKLVPAAGLSFMCYEALKRILLEEEEA 339



Score = 37.0 bits (84), Expect = 0.83
Identities = 16/47 (34%), Positives = 26/47 (55%)
Frame = -2

Query: 587 LYSSLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLR 447
+YSS A+R I ++ G Y GL PS + + P A ++ Y+ L+
Sbjct: 284 VYSSTLDALRGIVKERGISGLYRGLGPSCLKLVPAAGLSFMCYEALK 330


>tr|Q6E5A5|Q6E5A5_HORVD Plastidial ADP-glucose transporter
OS=Hordeum vulgare var. distichum PE=2 SV=2
Length = 425

Score = 128 bits (322), Expect = 2e-28
Identities = 70/152 (46%), Positives = 96/152 (63%), Gaps = 1/152 (0%)
Frame = -2

Query: 587 LYSSLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTGKNNVP 408
+Y +L A KI +DEG Y GL+PSL+GV PYAA N++ Y+ LR AYRR++GK V
Sbjct: 242 VYDNLLHAFVKIVRDEGPGELYRGLAPSLIGVVPYAAANFYAYETLRGAYRRASGKEEVG 301

Query: 407 TEATLVFGXXXXXXXXXVTYPLEVARRQMQL-SLTGAFVKKSTVGVILDIYQHEGFLALY 231
TL+ G T+PLEVAR+QMQ+ ++ G V K+ + + I EG LY
Sbjct: 302 NVPTLLIGSAAGAIASTATFPLEVARKQMQVGAVGGRQVYKNVLHAMYCILNKEGAAGLY 361

Query: 230 KGLGTTWLKLIPAAGISFVCYETARLALQIDD 135
+GLG + +KL+PAAGISF+CYE + L +DD
Sbjct: 362 RGLGPSCIKLMPAAGISFMCYEACKKIL-VDD 392



Score = 54.3 bits (129), Expect = 5e-06
Identities = 41/148 (27%), Positives = 66/148 (44%), Gaps = 7/148 (4%)
Frame = -2

Query: 578 SLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTGK-NNVPTE 402
S+ R I + EG+ + G + +++ V P A +F YD + G+ VP
Sbjct: 150 SMGGVFRWIMRTEGWPGLFRGNAVNVLRVAPSKAIEHFTYDTAKKYLTPEAGEPAKVPIP 209

Query: 401 ATLVFGXXXXXXXXXVTYPLEVARRQMQL------SLTGAFVKKSTVGVILDIYQHEGFL 240
LV G TYP+E+ + ++ + +L AFVK I + EG
Sbjct: 210 TPLVAGALAGVASTLCTYPMELVKTRLTIEKDVYDNLLHAFVK---------IVRDEGPG 260

Query: 239 ALYKGLGTTWLKLIPAAGISFVCYETAR 156
LY+GL + + ++P A +F YET R
Sbjct: 261 ELYRGLAPSLIGVVPYAAANFYAYETLR 288



Score = 33.9 bits (76), Expect = 7.1
Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 8/110 (7%)
Frame = -2

Query: 347 PLEVARRQMQLSLTGAFVKKSTVGVILDIYQHEGFLALYKGLGTTWLKLIPAAGISFVCY 168
PLE R + + +GA S GV I + EG+ L++G L++ P+ I Y
Sbjct: 133 PLETIRTHLMVGSSGA---DSMGGVFRWIMRTEGWPGLFRGNAVNVLRVAPSKAIEHFTY 189

Query: 167 ETARLALQIDDASLVKLEV-MPEQEG*L------ICSF-IELGKERKTQE 42
+TA+ L + K+ + P G L +C++ +EL K R T E
Sbjct: 190 DTAKKYLTPEAGEPAKVPIPTPLVAGALAGVASTLCTYPMELVKTRLTIE 239


>tr|A7P5R3|A7P5R3_VITVI Chromosome chr4 scaffold_6, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00032628001
PE=3 SV=1
Length = 397

Score = 127 bits (319), Expect = 5e-28
Identities = 68/148 (45%), Positives = 90/148 (60%), Gaps = 1/148 (0%)
Frame = -2

Query: 587 LYSSLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTGKNNVP 408
+Y+ L A KI Q+ G Y GL+PSL+GV PYAATNYF YD LR YR+ + +
Sbjct: 243 VYNGLLDAFVKILQEGGPAELYRGLTPSLIGVVPYAATNYFAYDTLRKTYRKILKQEKIG 302

Query: 407 TEATLVFGXXXXXXXXXVTYPLEVARRQMQL-SLTGAFVKKSTVGVILDIYQHEGFLALY 231
TL+ G T+PLEVAR+ MQ+ +L+G V K+ + + I + EG LY
Sbjct: 303 NIETLLIGSLAGAISSSATFPLEVARKHMQVGALSGRQVYKNVLHALSSILEQEGIPGLY 362

Query: 230 KGLGTTWLKLIPAAGISFVCYETARLAL 147
KGLG + LKL+PAAGISF+CYE + L
Sbjct: 363 KGLGPSCLKLVPAAGISFMCYEACKRIL 390


>tr|A5AV90|A5AV90_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_005135 PE=3 SV=1
Length = 397

Score = 127 bits (319), Expect = 5e-28
Identities = 68/148 (45%), Positives = 90/148 (60%), Gaps = 1/148 (0%)
Frame = -2

Query: 587 LYSSLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTGKNNVP 408
+Y+ L A KI Q+ G Y GL+PSL+GV PYAATNYF YD LR YR+ + +
Sbjct: 243 VYNGLFDAFVKILQEGGPAELYRGLTPSLIGVVPYAATNYFAYDTLRKTYRKILKQEKIG 302

Query: 407 TEATLVFGXXXXXXXXXVTYPLEVARRQMQL-SLTGAFVKKSTVGVILDIYQHEGFLALY 231
TL+ G T+PLEVAR+ MQ+ +L+G V K+ + + I + EG LY
Sbjct: 303 NIETLLIGSLAGAISSSATFPLEVARKHMQVGALSGRQVYKNVLHALSSILEQEGIPGLY 362

Query: 230 KGLGTTWLKLIPAAGISFVCYETARLAL 147
KGLG + LKL+PAAGISF+CYE + L
Sbjct: 363 KGLGPSCLKLVPAAGISFMCYEACKRIL 390


>tr|Q69XJ8|Q69XJ8_ORYSJ Os06g0602700 protein OS=Oryza sativa subsp.
japonica GN=P0486H12.22 PE=3 SV=1
Length = 419

Score = 126 bits (317), Expect = 8e-28
Identities = 67/152 (44%), Positives = 95/152 (62%), Gaps = 1/152 (0%)
Frame = -2

Query: 587 LYSSLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTGKNNVP 408
+Y++ A KI ++EG Y GL+PSL+GV PYAATNY+ YD L+ YR++ + +
Sbjct: 264 VYNNFLHAFVKILREEGPSELYRGLTPSLIGVVPYAATNYYAYDTLKKLYRKTFKQEEIS 323

Query: 407 TEATLVFGXXXXXXXXXVTYPLEVARRQMQL-SLTGAFVKKSTVGVILDIYQHEGFLALY 231
ATL+ G T+PLEVAR+QMQ+ ++ G V K+ + I ++EG LY
Sbjct: 324 NIATLLIGSAAGAISSTATFPLEVARKQMQVGAVGGRQVYKNVFHALYCIMENEGIGGLY 383

Query: 230 KGLGTTWLKLIPAAGISFVCYETARLALQIDD 135
KGLG + +KL+PAAGISF+CYE + L DD
Sbjct: 384 KGLGPSCIKLMPAAGISFMCYEACKKILVEDD 415


>tr|A2YER7|A2YER7_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_23612 PE=3 SV=1
Length = 419

Score = 126 bits (317), Expect = 8e-28
Identities = 67/152 (44%), Positives = 95/152 (62%), Gaps = 1/152 (0%)
Frame = -2

Query: 587 LYSSLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTGKNNVP 408
+Y++ A KI ++EG Y GL+PSL+GV PYAATNY+ YD L+ YR++ + +
Sbjct: 264 VYNNFLHAFVKILREEGPSELYRGLTPSLIGVVPYAATNYYAYDTLKKLYRKTFKQEEIS 323

Query: 407 TEATLVFGXXXXXXXXXVTYPLEVARRQMQL-SLTGAFVKKSTVGVILDIYQHEGFLALY 231
ATL+ G T+PLEVAR+QMQ+ ++ G V K+ + I ++EG LY
Sbjct: 324 NIATLLIGSAAGAISSTATFPLEVARKQMQVGAVGGRQVYKNVFHALYCIMENEGIGGLY 383

Query: 230 KGLGTTWLKLIPAAGISFVCYETARLALQIDD 135
KGLG + +KL+PAAGISF+CYE + L DD
Sbjct: 384 KGLGPSCIKLMPAAGISFMCYEACKKILVEDD 415


>tr|Q9ZNY4|Q9ZNY4_SOLTU Mitochondrial energy transfer protein
OS=Solanum tuberosum GN=brittle1 PE=2 SV=1
Length = 385

Score = 126 bits (316), Expect = 1e-27
Identities = 64/148 (43%), Positives = 92/148 (62%), Gaps = 1/148 (0%)
Frame = -2

Query: 587 LYSSLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTGKNNVP 408
+Y+ L A KI ++ G Y GL+PS++GV PYAATNYF YD LR AYR+ + +
Sbjct: 231 VYNGLLDAFVKILKEGGPAELYRGLTPSVIGVIPYAATNYFAYDSLRKAYRKIFKEEKIG 290

Query: 407 TEATLVFGXXXXXXXXXVTYPLEVARRQMQL-SLTGAFVKKSTVGVILDIYQHEGFLALY 231
TL+ G T+PLEVAR+ MQ+ +++G V K+ + ++ I + +G LY
Sbjct: 291 NIETLLIGSAAGAISSTATFPLEVARKHMQVGAVSGRAVYKNVIHALVSILEQDGIHGLY 350

Query: 230 KGLGTTWLKLIPAAGISFVCYETARLAL 147
KGLG + +KL+PAAGISF+CYE + L
Sbjct: 351 KGLGPSCMKLVPAAGISFMCYEACKRIL 378



Score = 53.9 bits (128), Expect = 7e-06
Identities = 40/150 (26%), Positives = 68/150 (45%), Gaps = 7/150 (4%)
Frame = -2

Query: 578 SLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTG-KNNVPTE 402
S ++ I + EG+ + G +++ V P A FVYD + G ++ +P
Sbjct: 139 SSTEVFNSIMKTEGWTGLFRGNFVNVIRVAPSKAVELFVYDTVNKNLSSKPGEQSKIPIP 198

Query: 401 ATLVFGXXXXXXXXXVTYPLEVARRQMQL------SLTGAFVKKSTVGVILDIYQHEGFL 240
A+LV G +TYPLE+ + ++ + L AFVK I + G
Sbjct: 199 ASLVAGACAGVSSTLLTYPLELVKTRLTIQRGVYNGLLDAFVK---------ILKEGGPA 249

Query: 239 ALYKGLGTTWLKLIPAAGISFVCYETARLA 150
LY+GL + + +IP A ++ Y++ R A
Sbjct: 250 ELYRGLTPSVIGVIPYAATNYFAYDSLRKA 279


>tr|Q65XR7|Q65XR7_ORYSJ Os05g0171300 protein OS=Oryza sativa subsp.
japonica GN=P0685E10.12 PE=2 SV=1
Length = 415

Score = 126 bits (316), Expect = 1e-27
Identities = 65/148 (43%), Positives = 92/148 (62%), Gaps = 1/148 (0%)
Frame = -2

Query: 587 LYSSLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTGKNNVP 408
+Y + A+ KI ++EG Y GL+PSL+GV PYAATNYF YD L+ AY++ N +
Sbjct: 262 VYDNFLHALVKIVREEGPTELYRGLTPSLIGVVPYAATNYFAYDTLKKAYKKMFKTNEIG 321

Query: 407 TEATLVFGXXXXXXXXXVTYPLEVARRQMQL-SLTGAFVKKSTVGVILDIYQHEGFLALY 231
TL+ G T+PLEVAR+ MQ+ ++ G V K+ + +L I + EG LY
Sbjct: 322 NVPTLLIGSAAGAISSTATFPLEVARKHMQVGAVGGRKVYKNMLHALLSILEDEGVGGLY 381

Query: 230 KGLGTTWLKLIPAAGISFVCYETARLAL 147
+GLG + +KL+PAAGISF+CYE + L
Sbjct: 382 RGLGPSCMKLVPAAGISFMCYEACKKVL 409


>tr|Q38M74|Q38M74_SOLTU Brittle 1 protein-like OS=Solanum tuberosum
PE=2 SV=1
Length = 398

Score = 126 bits (316), Expect = 1e-27
Identities = 64/148 (43%), Positives = 92/148 (62%), Gaps = 1/148 (0%)
Frame = -2

Query: 587 LYSSLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTGKNNVP 408
+Y+ L A KI ++ G Y GL+PS++GV PYAATNYF YD LR AYR+ + +
Sbjct: 244 VYNGLLDAFVKILKEGGPAELYRGLTPSVIGVIPYAATNYFAYDSLRKAYRKIFKEEKIG 303

Query: 407 TEATLVFGXXXXXXXXXVTYPLEVARRQMQL-SLTGAFVKKSTVGVILDIYQHEGFLALY 231
TL+ G T+PLEVAR+ MQ+ +++G V K+ + ++ I + +G LY
Sbjct: 304 NIETLLIGSAAGAISSTATFPLEVARKHMQVGAVSGRAVYKNVIHALVSILEQDGIHGLY 363

Query: 230 KGLGTTWLKLIPAAGISFVCYETARLAL 147
KGLG + +KL+PAAGISF+CYE + L
Sbjct: 364 KGLGPSCMKLVPAAGISFMCYEACKRIL 391



Score = 53.9 bits (128), Expect = 7e-06
Identities = 40/150 (26%), Positives = 68/150 (45%), Gaps = 7/150 (4%)
Frame = -2

Query: 578 SLSQAIRKIAQDEGFLAFYSGLSPSLVGVFPYAATNYFVYDGLRTAYRRSTG-KNNVPTE 402
S ++ I + EG+ + G +++ V P A FVYD + G ++ +P
Sbjct: 152 SSTEVFNSIMKTEGWTGLFRGNFVNVIRVAPSKAVELFVYDTVNKNLSSKPGEQSKIPIP 211

Query: 401 ATLVFGXXXXXXXXXVTYPLEVARRQMQL------SLTGAFVKKSTVGVILDIYQHEGFL 240
A+LV G +TYPLE+ + ++ + L AFVK I + G
Sbjct: 212 ASLVAGACAGVSSTLLTYPLELVKTRLTIQRGVYNGLLDAFVK---------ILKEGGPA 262

Query: 239 ALYKGLGTTWLKLIPAAGISFVCYETARLA 150
LY+GL + + +IP A ++ Y++ R A
Sbjct: 263 ELYRGLTPSVIGVIPYAATNYFAYDSLRKA 292