BP916397
Clone id YMU001_000087_C04
Library
Length 583
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000087_C04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GTGGGAATCATCACCAATGGGCATGCTAAGGTTCAAAGAGCAAAGTTGAAGGCCTGCAAA
GCAGAGGATCTCTTCAGTGTCATCCTTGTGGGGGGAGAGGAACCCAACGAAAAGCCACAC
AAGGAGATATTTATAAAGGCATGCAAGATGGCGGGATGTGAACCTGAGAAAGCTATCATG
ATCGGAGACAACTTAAAAACTGACATACAGGGTGGATTGAATGCCAATTTTTTGGCTACA
ATTTGGGTTGATCTTCATGGAATGGGAAATACCATTGGATGTCCGAGGCCTCACCATACA
GTGAGAAATATATATGAGCTGCATGATATTCTTAAGCAGTATGGATGTCCAATATAAGTG
TGGACTAATGTAATGAAGATACTATCAAGTCTTATGAACTCTTTGCGGGACAGGCAAATT
ATTTTTACTGAGGACAGAGGAATAAGATTAGTTCTATTTCTATTGAGATATCTGATGGAT
GGTCATAAGAACATCGGTGAGAAGCATTAGAAATCATGTTAATTGGCTAATTGATGTGTA
CTTTATTCTGACTCTGTGATCAAAGATTTGATAGATTGGTGGT
■■Homology search results ■■ -
sp_hit_id Q9CPT3
Definition sp|Q9CPT3|NANP_MOUSE N-acylneuraminate-9-phosphatase OS=Mus musculus
Align length 116
Score (bit) 107.0
E-value 6.0e-23
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916397|Adiantum capillus-veneris mRNA, clone:
YMU001_000087_C04.
(583 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9CPT3|NANP_MOUSE N-acylneuraminate-9-phosphatase OS=Mus musc... 107 6e-23
sp|Q5M969|NANP_RAT N-acylneuraminate-9-phosphatase OS=Rattus nor... 106 7e-23
sp|Q8TBE9|NANP_HUMAN N-acylneuraminate-9-phosphatase OS=Homo sap... 106 7e-23
sp|P0A8Y1|YJJG_ECOLI 5'-nucleotidase yjjG OS=Escherichia coli (s... 70 1e-11
sp|P0A8Y2|YJJG_ECO57 5'-nucleotidase yjjG OS=Escherichia coli O1... 70 1e-11
sp|Q8U040|Y1777_PYRFU Uncharacterized HAD-hydrolase PF1777 OS=Py... 62 2e-09
sp|O59346|Y1655_PYRHO Uncharacterized HAD-hydrolase PH1655 OS=Py... 60 1e-08
sp|Q9V1B3|YB10_PYRAB Uncharacterized HAD-hydrolase PYRAB05140 OS... 58 3e-08
sp|P94512|YSAA_BACSU Putative uncharacterized hydrolase ysaA OS=... 57 7e-08
sp|Q3J8A0|GPH_NITOC Phosphoglycolate phosphatase OS=Nitrosococcu... 54 6e-07
sp|O26311|Y209_METTH Uncharacterized HAD-hydrolase MTH_209 OS=Me... 53 1e-06
sp|Q8TWR2|Y970_METKA Uncharacterized HAD-hydrolase MK0970 OS=Met... 52 3e-06
sp|Q6HBC8|PPAX_BACHK Pyrophosphatase ppaX OS=Bacillus thuringien... 51 4e-06
sp|Q631J2|PPAX_BACCZ Pyrophosphatase ppaX OS=Bacillus cereus (st... 51 4e-06
sp|Q6HQY9|PPAX_BACAN Pyrophosphatase ppaX OS=Bacillus anthracis ... 51 4e-06
sp|A0RKU8|PPAX_BACAH Pyrophosphatase ppaX OS=Bacillus thuringien... 51 4e-06
sp|Q72XV8|PPAX_BACC1 Pyrophosphatase ppaX OS=Bacillus cereus (st... 51 5e-06
sp|Q815I8|PPAX_BACCR Pyrophosphatase ppaX OS=Bacillus cereus (st... 50 1e-05
sp|Q5R4B4|HDHD2_PONAB Haloacid dehalogenase-like hydrolase domai... 45 2e-04
sp|Q9H0R4|HDHD2_HUMAN Haloacid dehalogenase-like hydrolase domai... 45 2e-04
sp|Q3ZCH9|HDHD2_BOVIN Haloacid dehalogenase-like hydrolase domai... 45 2e-04
sp|Q3UGR5|HDHD2_MOUSE Haloacid dehalogenase-like hydrolase domai... 44 5e-04
sp|Q5BJJ5|HDHD2_DANRE Haloacid dehalogenase-like hydrolase domai... 44 6e-04
sp|Q3YWN8|GPH_SHISS Phosphoglycolate phosphatase OS=Shigella son... 44 8e-04
sp|Q83PX1|GPH_SHIFL Phosphoglycolate phosphatase OS=Shigella fle... 44 8e-04
sp|Q32AJ7|GPH_SHIDS Phosphoglycolate phosphatase OS=Shigella dys... 44 8e-04
sp|Q31VP9|GPH_SHIBS Phosphoglycolate phosphatase OS=Shigella boy... 44 8e-04
sp|Q4FPT7|GPH_PSYA2 Phosphoglycolate phosphatase OS=Psychrobacte... 44 8e-04
sp|P32662|GPH_ECOLI Phosphoglycolate phosphatase OS=Escherichia ... 44 8e-04
sp|Q8FCW0|GPH_ECOL6 Phosphoglycolate phosphatase OS=Escherichia ... 44 8e-04

>sp|Q9CPT3|NANP_MOUSE N-acylneuraminate-9-phosphatase OS=Mus
musculus GN=Nanp PE=1 SV=1
Length = 248

Score = 107 bits (266), Expect = 6e-23
Identities = 46/116 (39%), Positives = 69/116 (59%)
Frame = +1

Query: 7 IITNGHAKVQRAKLKACKAEDLFSVILVGGEEPNEKPHKEIFIKACKMAGCEPEKAIMIG 186
++TNG + QR K++AC + F I++GGE+ EKP IF C + G +P +M+G
Sbjct: 129 LLTNGDRQTQREKIEACACQSYFDAIVIGGEQKEEKPAPSIFYHCCDLLGVQPGDCVMVG 188

Query: 187 DNLKTDIQGGLNANFLATIWVDLHGMGNTIGCPRPHHTVRNIYELHDILKQYGCPI 354
D L+TDIQGGLNA AT+W++ G P PH+ V ++ EL +L+ C +
Sbjct: 189 DTLETDIQGGLNAGLKATVWINKSGRVPLTSSPMPHYMVSSVLELPALLQSIDCKV 244


>sp|Q5M969|NANP_RAT N-acylneuraminate-9-phosphatase OS=Rattus
norvegicus GN=Nanp PE=1 SV=1
Length = 248

Score = 106 bits (265), Expect = 7e-23
Identities = 47/116 (40%), Positives = 69/116 (59%)
Frame = +1

Query: 7 IITNGHAKVQRAKLKACKAEDLFSVILVGGEEPNEKPHKEIFIKACKMAGCEPEKAIMIG 186
++TNG + QR K++AC + F I+VGGE+ EKP IF C + G +P +M+G
Sbjct: 129 LLTNGDRQTQREKIEACACQSYFDAIVVGGEQKEEKPAPSIFYHCCDLLGVQPGDCVMVG 188

Query: 187 DNLKTDIQGGLNANFLATIWVDLHGMGNTIGCPRPHHTVRNIYELHDILKQYGCPI 354
D L+TDIQGGLNA AT+W++ G P PH+ V ++ EL +L+ C +
Sbjct: 189 DTLETDIQGGLNAGLKATVWINKSGGVPLTSSPMPHYMVSSVLELPALLQSIDCKV 244


>sp|Q8TBE9|NANP_HUMAN N-acylneuraminate-9-phosphatase OS=Homo
sapiens GN=NANP PE=1 SV=1
Length = 248

Score = 106 bits (265), Expect = 7e-23
Identities = 46/116 (39%), Positives = 71/116 (61%)
Frame = +1

Query: 7 IITNGHAKVQRAKLKACKAEDLFSVILVGGEEPNEKPHKEIFIKACKMAGCEPEKAIMIG 186
++TNG + QR K++AC + F ++VGGE+ EKP IF C + G +P +M+G
Sbjct: 129 LLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVG 188

Query: 187 DNLKTDIQGGLNANFLATIWVDLHGMGNTIGCPRPHHTVRNIYELHDILKQYGCPI 354
D L+TDIQGGLNA AT+W++ +G+ P PH+ V ++ EL +L+ C +
Sbjct: 189 DTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKV 244


>sp|P0A8Y1|YJJG_ECOLI 5'-nucleotidase yjjG OS=Escherichia coli
(strain K12) GN=yjjG PE=1 SV=1
Length = 225

Score = 69.7 bits (169), Expect = 1e-11
Identities = 40/112 (35%), Positives = 66/112 (58%), Gaps = 1/112 (0%)
Frame = +1

Query: 1 VGIITNGHAKVQRAKLKACKAEDLFSVILVGGEEPNEKPHKEIFIKACKMAG-CEPEKAI 177
+GIITNG + +Q+ +L+ D F ++++ E KP+K+IF A + AG + + +
Sbjct: 113 IGIITNGFSALQQVRLERTGLRDYFDLLVISEEVGVAKPNKKIFDYALEQAGNPDRSRVL 172

Query: 178 MIGDNLKTDIQGGLNANFLATIWVDLHGMGNTIGCPRPHHTVRNIYELHDIL 333
M+GD ++DI GG+NA LAT W++ H G P TV +++EL +L
Sbjct: 173 MVGDTAESDILGGINAG-LATCWLNAHHREQPEGI-APTWTVSSLHELEQLL 222


>sp|P0A8Y2|YJJG_ECO57 5'-nucleotidase yjjG OS=Escherichia coli
O157:H7 GN=yjjG PE=3 SV=1
Length = 225

Score = 69.7 bits (169), Expect = 1e-11
Identities = 40/112 (35%), Positives = 66/112 (58%), Gaps = 1/112 (0%)
Frame = +1

Query: 1 VGIITNGHAKVQRAKLKACKAEDLFSVILVGGEEPNEKPHKEIFIKACKMAG-CEPEKAI 177
+GIITNG + +Q+ +L+ D F ++++ E KP+K+IF A + AG + + +
Sbjct: 113 IGIITNGFSALQQVRLERTGLRDYFDLLVISEEVGVAKPNKKIFDYALEQAGNPDRSRVL 172

Query: 178 MIGDNLKTDIQGGLNANFLATIWVDLHGMGNTIGCPRPHHTVRNIYELHDIL 333
M+GD ++DI GG+NA LAT W++ H G P TV +++EL +L
Sbjct: 173 MVGDTAESDILGGINAG-LATCWLNAHHREQPEGI-APTWTVSSLHELEQLL 222


>sp|Q8U040|Y1777_PYRFU Uncharacterized HAD-hydrolase PF1777
OS=Pyrococcus furiosus GN=PF1777 PE=3 SV=1
Length = 240

Score = 62.0 bits (149), Expect = 2e-09
Identities = 32/81 (39%), Positives = 48/81 (59%)
Frame = +1

Query: 4 GIITNGHAKVQRAKLKACKAEDLFSVILVGGEEPNEKPHKEIFIKACKMAGCEPEKAIMI 183
GIIT+G+ Q K+ + +D F +++ E +KPH +IF KA K +PE+AIM+
Sbjct: 116 GIITDGNPIKQWEKILRLELDDFFEHVMISDFEGVKKPHPKIFKKALKAFNVKPEEAIMV 175

Query: 184 GDNLKTDIQGGLNANFLATIW 246
GD L +DI G N + T+W
Sbjct: 176 GDRLYSDIYGAKNVG-MKTVW 195


>sp|O59346|Y1655_PYRHO Uncharacterized HAD-hydrolase PH1655
OS=Pyrococcus horikoshii GN=PH1655 PE=1 SV=1
Length = 241

Score = 59.7 bits (143), Expect = 1e-08
Identities = 30/82 (36%), Positives = 48/82 (58%)
Frame = +1

Query: 1 VGIITNGHAKVQRAKLKACKAEDLFSVILVGGEEPNEKPHKEIFIKACKMAGCEPEKAIM 180
+GIIT+G+ Q K+ + +D F +++ E +KPH +IF KA K +PE+A+M
Sbjct: 113 LGIITDGNPVKQWEKILRLELDDFFEHVIISDFEGVKKPHPKIFKKALKAFNVKPEEALM 172

Query: 181 IGDNLKTDIQGGLNANFLATIW 246
+GD L +DI G + T+W
Sbjct: 173 VGDRLYSDIYGAKRVG-MKTVW 193


>sp|Q9V1B3|YB10_PYRAB Uncharacterized HAD-hydrolase PYRAB05140
OS=Pyrococcus abyssi GN=PYRAB05140 PE=3 SV=1
Length = 238

Score = 58.2 bits (139), Expect = 3e-08
Identities = 29/82 (35%), Positives = 48/82 (58%)
Frame = +1

Query: 1 VGIITNGHAKVQRAKLKACKAEDLFSVILVGGEEPNEKPHKEIFIKACKMAGCEPEKAIM 180
+GIIT+G+ Q K+ + +D F +++ E +KPH +IF KA K + ++A+M
Sbjct: 113 LGIITDGNPVKQWEKILRLEIDDFFEHVIISDFEGVKKPHPKIFKKALKAFNVDAQEALM 172

Query: 181 IGDNLKTDIQGGLNANFLATIW 246
+GD L +DI G N + T+W
Sbjct: 173 VGDRLYSDIYGAKNVG-MKTVW 193


>sp|P94512|YSAA_BACSU Putative uncharacterized hydrolase ysaA
OS=Bacillus subtilis GN=ysaA PE=3 SV=1
Length = 260

Score = 57.0 bits (136), Expect = 7e-08
Identities = 34/112 (30%), Positives = 58/112 (51%), Gaps = 1/112 (0%)
Frame = +1

Query: 7 IITNGHAKVQRAKLKAC-KAEDLFSVILVGGEEPNEKPHKEIFIKACKMAGCEPEKAIMI 183
++TNG +Q+ KL + F+ I++ G KP IF K+ E + AIM+
Sbjct: 151 LLTNGDPSLQKEKLAGVPELAPYFNEIVISGAFGKGKPDVSIFEHCLKLMNIEKDDAIMV 210

Query: 184 GDNLKTDIQGGLNANFLATIWVDLHGMGNTIGCPRPHHTVRNIYELHDILKQ 339
GDNL TDI G A + T+W++ N +P + + ++++L IL++
Sbjct: 211 GDNLNTDILGASRAG-IKTVWINRTDKKNETDV-KPDYIISSLHDLFPILEK 260


>sp|Q3J8A0|GPH_NITOC Phosphoglycolate phosphatase OS=Nitrosococcus
oceani (strain ATCC 19707 / NCIMB 11848) GN=Noc_2493
PE=3 SV=1
Length = 225

Score = 53.9 bits (128), Expect = 6e-07
Identities = 33/113 (29%), Positives = 54/113 (47%)
Frame = +1

Query: 1 VGIITNGHAKVQRAKLKACKAEDLFSVILVGGEEPNEKPHKEIFIKACKMAGCEPEKAIM 180
VG +TN A+ L D F +++ G P +KPH + A G PEKA+M
Sbjct: 112 VGCVTNKAAQFTYPLLTELGIIDYFEIVISGDTLPEKKPHPAPLLHAASHFGIAPEKALM 171

Query: 181 IGDNLKTDIQGGLNANFLATIWVDLHGMGNTIGCPRPHHTVRNIYELHDILKQ 339
IGD++ +D++ ANF + G I +P + ++ E+ ++L Q
Sbjct: 172 IGDSI-SDVKAARAANFQIVCLSYGYNHGVDIRDSQPDSVIDSLIEIKNLLSQ 223


tr_hit_id A9NPI1
Definition tr|A9NPI1|A9NPI1_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 115
Score (bit) 162.0
E-value 1.0e-38
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916397|Adiantum capillus-veneris mRNA, clone:
YMU001_000087_C04.
(583 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NPI1|A9NPI1_PICSI Putative uncharacterized protein OS=Picea... 162 1e-38
tr|A9TI28|A9TI28_PHYPA Predicted protein OS=Physcomitrella paten... 160 5e-38
tr|A7YWM8|A7YWM8_BOVIN NANP protein OS=Bos taurus GN=NANP PE=2 SV=1 108 2e-22
tr|Q6NUA9|Q6NUA9_XENLA MGC81095 protein OS=Xenopus laevis GN=nan... 108 3e-22
tr|A2ANC0|A2ANC0_MOUSE N-acetylneuraminic acid phosphatase OS=Mu... 107 6e-22
tr|B3KP12|B3KP12_HUMAN cDNA FLJ30910 fis, clone FEBRA2006270, hi... 106 8e-22
tr|Q28I22|Q28I22_XENTR Haloacid dehalogenase-like hydrolase doma... 102 2e-20
tr|Q5ZJP4|Q5ZJP4_CHICK Putative uncharacterized protein OS=Gallu... 99 2e-19
tr|Q502P8|Q502P8_DANRE Zgc:111947 OS=Danio rerio GN=zgc:111947 P... 97 7e-19
tr|B8JKD6|B8JKD6_DANRE Novel protein similar to H.sapiens NANP, ... 96 1e-18
tr|A7RJ30|A7RJ30_NEMVE Predicted protein OS=Nematostella vectens... 88 3e-16
tr|A8T652|A8T652_9VIBR Putative uncharacterized protein OS=Vibri... 88 4e-16
tr|B6NF52|B6NF52_BRAFL Putative uncharacterized protein (Fragmen... 86 2e-15
tr|A6AWG0|A6AWG0_VIBHA Putative uncharacterized protein OS=Vibri... 82 3e-14
tr|Q4TBC5|Q4TBC5_TETNG Chromosome undetermined SCAF7151, whole g... 80 6e-14
tr|A7N1A3|A7N1A3_VIBHB Putative uncharacterized protein OS=Vibri... 80 6e-14
tr|Q87TM5|Q87TM5_VIBPA Putative uncharacterized protein VP0044 O... 80 1e-13
tr|A6B4T0|A6B4T0_VIBPA Putative uncharacterized protein OS=Vibri... 80 1e-13
tr|A7K0R7|A7K0R7_9VIBR Putative uncharacterized protein OS=Vibri... 78 4e-13
tr|Q17H24|Q17H24_AEDAE Putative uncharacterized protein OS=Aedes... 77 9e-13
tr|B4NDG2|B4NDG2_DROWI GK24925 OS=Drosophila willistoni GN=GK249... 77 9e-13
tr|Q5TT02|Q5TT02_ANOGA AGAP004391-PA (Fragment) OS=Anopheles gam... 76 1e-12
tr|B4M7K6|B4M7K6_DROVI GJ17009 OS=Drosophila virilis GN=GJ17009 ... 76 2e-12
tr|B4L6L6|B4L6L6_DROMO GI16391 OS=Drosophila mojavensis GN=GI163... 75 3e-12
tr|Q1VAZ3|Q1VAZ3_VIBAL Putative uncharacterized protein OS=Vibri... 74 5e-12
tr|Q29FS6|Q29FS6_DROPS GA13946 OS=Drosophila pseudoobscura pseud... 74 6e-12
tr|B4GU22|B4GU22_DROPE GL14466 OS=Drosophila persimilis GN=GL144... 74 6e-12
tr|Q2C1E6|Q2C1E6_9GAMM Putative uncharacterized protein OS=Photo... 74 8e-12
tr|Q1ZPZ0|Q1ZPZ0_9VIBR Putative uncharacterized protein OS=Vibri... 73 1e-11
tr|B0WNH8|B0WNH8_CULQU Putative uncharacterized protein OS=Culex... 73 1e-11

>tr|A9NPI1|A9NPI1_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 249

Score = 162 bits (410), Expect = 1e-38
Identities = 74/115 (64%), Positives = 96/115 (83%), Gaps = 1/115 (0%)
Frame = +1

Query: 1 VGIITNGHAKVQRAKLKACKAEDLFSVILVGGEEPNEKPHKEIFIKACKMAGCEPEKAIM 180
VGIITNGH KVQRAKL AC+A++LF+ ILVGGEE +EKPHK IF+KAC++ GC PE+++M
Sbjct: 135 VGIITNGHPKVQRAKLLACRADELFNTILVGGEEVHEKPHKSIFLKACELVGCTPEQSVM 194

Query: 181 IGDNLKTDIQGGLNANFLATIWVDLHGMGN-TIGCPRPHHTVRNIYELHDILKQY 342
+GDNLKTDIQGG NA FLAT+WV++HG+ + IG +P +T+RNI EL ++L Y
Sbjct: 195 VGDNLKTDIQGGKNAGFLATVWVNVHGLNDPPIGAAKPTYTIRNICELPEVLPLY 249


>tr|A9TI28|A9TI28_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_170201 PE=4 SV=1
Length = 345

Score = 160 bits (405), Expect = 5e-38
Identities = 76/114 (66%), Positives = 91/114 (79%), Gaps = 1/114 (0%)
Frame = +1

Query: 1 VGIITNGHAKVQRAKLKACKAEDLFSVILVGGEEPNEKPHKEIFIKACKMAGCEPEKAIM 180
VGIITNGH VQR KLKACKA+ LF ILVGGEEPN+KPH+EIF+KAC++AGC PE+ IM
Sbjct: 224 VGIITNGHFSVQRDKLKACKADLLFDTILVGGEEPNQKPHREIFLKACRLAGCSPEETIM 283

Query: 181 IGDNLKTDIQGGLNANFLATIWVDLHGM-GNTIGCPRPHHTVRNIYELHDILKQ 339
+GDNLKTDIQGG+NA FLAT+WV++H + G G P H + NI EL +LKQ
Sbjct: 284 VGDNLKTDIQGGINAGFLATVWVNVHNLEGLPAGGATPDHIISNIGELPGLLKQ 337


>tr|A7YWM8|A7YWM8_BOVIN NANP protein OS=Bos taurus GN=NANP PE=2 SV=1
Length = 248

Score = 108 bits (270), Expect = 2e-22
Identities = 49/120 (40%), Positives = 73/120 (60%)
Frame = +1

Query: 7 IITNGHAKVQRAKLKACKAEDLFSVILVGGEEPNEKPHKEIFIKACKMAGCEPEKAIMIG 186
++TNG + QR K++AC + F I+VGGE+ EKP IF +C + G +P +M+G
Sbjct: 129 LLTNGERQTQREKIEACACQSYFDAIVVGGEQKEEKPAPSIFYYSCDLLGVQPGDCVMVG 188

Query: 187 DNLKTDIQGGLNANFLATIWVDLHGMGNTIGCPRPHHTVRNIYELHDILKQYGCPI*VWT 366
D L+TDIQGGLNA AT+W++ +G+ P PH+ V ++ EL +L C + V T
Sbjct: 189 DTLETDIQGGLNAGLKATVWINKNGVVPLKSSPTPHYIVSSVLELPALLHSIDCKVSVST 248


>tr|Q6NUA9|Q6NUA9_XENLA MGC81095 protein OS=Xenopus laevis GN=nanp
PE=2 SV=1
Length = 240

Score = 108 bits (269), Expect = 3e-22
Identities = 49/110 (44%), Positives = 72/110 (65%)
Frame = +1

Query: 7 IITNGHAKVQRAKLKACKAEDLFSVILVGGEEPNEKPHKEIFIKACKMAGCEPEKAIMIG 186
++TNG +VQR K+++C A+ F ++VGGE EKP IF C + G P +M+G
Sbjct: 129 LLTNGVRQVQREKIESCGAQQFFDAVVVGGEHAEEKPAPSIFYHCCDLIGVLPGDCVMVG 188

Query: 187 DNLKTDIQGGLNANFLATIWVDLHGMGNTIGCPRPHHTVRNIYELHDILK 336
DNL TDIQGGLNA ATIW++ + N + P PH+T++++ E+ D+LK
Sbjct: 189 DNLDTDIQGGLNAGLKATIWINQNPSINKV-MPTPHYTIKSVMEVPDVLK 237


>tr|A2ANC0|A2ANC0_MOUSE N-acetylneuraminic acid phosphatase OS=Mus
musculus GN=Nanp PE=4 SV=1
Length = 248

Score = 107 bits (266), Expect = 6e-22
Identities = 46/116 (39%), Positives = 69/116 (59%)
Frame = +1

Query: 7 IITNGHAKVQRAKLKACKAEDLFSVILVGGEEPNEKPHKEIFIKACKMAGCEPEKAIMIG 186
++TNG + QR K++AC + F I++GGE+ EKP IF C + G +P +M+G
Sbjct: 129 LLTNGDRQTQREKIEACACQSYFDAIVIGGEQKEEKPAPSIFYHCCDLLGVQPGDCVMVG 188

Query: 187 DNLKTDIQGGLNANFLATIWVDLHGMGNTIGCPRPHHTVRNIYELHDILKQYGCPI 354
D L+TDIQGGLNA AT+W++ G P PH+ V ++ EL +L+ C +
Sbjct: 189 DTLETDIQGGLNAGLKATVWINKSGRVPLTSSPMPHYMVSSVLELPALLQSIDCKV 244


>tr|B3KP12|B3KP12_HUMAN cDNA FLJ30910 fis, clone FEBRA2006270,
highly similar to N-acylneuraminate-9-phosphatase (EC
3.1.3.29) OS=Homo sapiens GN=NANP PE=2 SV=1
Length = 248

Score = 106 bits (265), Expect = 8e-22
Identities = 46/116 (39%), Positives = 71/116 (61%)
Frame = +1

Query: 7 IITNGHAKVQRAKLKACKAEDLFSVILVGGEEPNEKPHKEIFIKACKMAGCEPEKAIMIG 186
++TNG + QR K++AC + F ++VGGE+ EKP IF C + G +P +M+G
Sbjct: 129 LLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVG 188

Query: 187 DNLKTDIQGGLNANFLATIWVDLHGMGNTIGCPRPHHTVRNIYELHDILKQYGCPI 354
D L+TDIQGGLNA AT+W++ +G+ P PH+ V ++ EL +L+ C +
Sbjct: 189 DTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKV 244


>tr|Q28I22|Q28I22_XENTR Haloacid dehalogenase-like hydrolase domain
containing 4 OS=Xenopus tropicalis GN=nanp PE=2 SV=1
Length = 240

Score = 102 bits (253), Expect = 2e-20
Identities = 48/110 (43%), Positives = 70/110 (63%)
Frame = +1

Query: 7 IITNGHAKVQRAKLKACKAEDLFSVILVGGEEPNEKPHKEIFIKACKMAGCEPEKAIMIG 186
++TNG +VQR K+++C A+ F ++VGGE EKP IF C + P +M+G
Sbjct: 129 LLTNGVGQVQREKIESCGAQQFFDAVVVGGEHAEEKPAPSIFYHCCDLIRVLPGDCVMVG 188

Query: 187 DNLKTDIQGGLNANFLATIWVDLHGMGNTIGCPRPHHTVRNIYELHDILK 336
DNL TDIQGGLNA ATIW++ + + P PH+TV+++ E+ D+LK
Sbjct: 189 DNLDTDIQGGLNAGLKATIWLNKNPSIIKVS-PTPHYTVKSVMEVPDVLK 237


>tr|Q5ZJP4|Q5ZJP4_CHICK Putative uncharacterized protein OS=Gallus
gallus GN=RCJMB04_16l17 PE=2 SV=1
Length = 268

Score = 98.6 bits (244), Expect = 2e-19
Identities = 43/111 (38%), Positives = 68/111 (61%)
Frame = +1

Query: 7 IITNGHAKVQRAKLKACKAEDLFSVILVGGEEPNEKPHKEIFIKACKMAGCEPEKAIMIG 186
++TNG + QR K++AC + F I+VGGE+ EKP IF C + G +P + +M+G
Sbjct: 137 LLTNGDRQTQREKIEACACQPYFDAIVVGGEQKEEKPAPSIFHYCCDLLGVQPAECVMVG 196

Query: 187 DNLKTDIQGGLNANFLATIWVDLHGMGNTIGCPRPHHTVRNIYELHDILKQ 339
D+L TDIQGGLNA AT+W++ P PH+ + ++ +L +L++
Sbjct: 197 DSLDTDIQGGLNAGLRATVWLNKSMAAPADASPVPHYVISSVLDLPAVLQK 247


>tr|Q502P8|Q502P8_DANRE Zgc:111947 OS=Danio rerio GN=zgc:111947 PE=2
SV=1
Length = 242

Score = 97.1 bits (240), Expect = 7e-19
Identities = 43/111 (38%), Positives = 69/111 (62%)
Frame = +1

Query: 7 IITNGHAKVQRAKLKACKAEDLFSVILVGGEEPNEKPHKEIFIKACKMAGCEPEKAIMIG 186
++TNG + QR K++A + E LFS+++VGG+ P +KP + IF + AG P+ IM+G
Sbjct: 130 LLTNGDTQTQREKIEAVRCEGLFSLVVVGGDRPEQKPARSIFTHCFESAGVRPQDCIMVG 189

Query: 187 DNLKTDIQGGLNANFLATIWVDLHGMGNTIGCPRPHHTVRNIYELHDILKQ 339
D+L TDIQGG+NA AT+W++ P +T+ + L+++L Q
Sbjct: 190 DSLTTDIQGGINAGVRATVWINAGSKSLPQDSVTPDYTLPTVLHLNEVLAQ 240


>tr|B8JKD6|B8JKD6_DANRE Novel protein similar to H.sapiens NANP,
N-acetylneuraminic acid phosphatase (NANP, zgc:111947)
OS=Danio rerio GN=DKEY-18N13.3 PE=4 SV=1
Length = 243

Score = 95.9 bits (237), Expect = 1e-18
Identities = 43/111 (38%), Positives = 68/111 (61%)
Frame = +1

Query: 7 IITNGHAKVQRAKLKACKAEDLFSVILVGGEEPNEKPHKEIFIKACKMAGCEPEKAIMIG 186
++TNG + QR K++A + E LFS+++VGG+ P +KP + IF + AG P+ IM+G
Sbjct: 131 LLTNGDTQTQREKIEAVRCEGLFSLVVVGGDHPEQKPARSIFTHCFESAGVRPQDCIMVG 190

Query: 187 DNLKTDIQGGLNANFLATIWVDLHGMGNTIGCPRPHHTVRNIYELHDILKQ 339
D+L TDIQGG+NA AT+W++ P +T+ + L ++L Q
Sbjct: 191 DSLTTDIQGGVNAGVRATVWINAGSKSLPQDSVTPDYTLPTVLHLKEVLAQ 241