BP916401
Clone id YMU001_000087_C08
Library
Length 374
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000087_C08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATATCTGTGGAGTTGTGCTTCTGCTCTTTGCTTCTGCAGTTGACGACCATGTAATTAGGA
AAAATTGAAATTTTGTTCCGTAATTCGCCAAATAACACATATGAACATAGACCTTGATGG
GTGACAATACCAGGTGTAGATTTGACTTTAGGTTCTGCATAGCATGAGCTTATGAGCAAA
CAATCAACAAAATGAGCCTACTTATTCAGACCATGATGTATCTGAATCGCCAAATAACAC
ATATGAACATAGACCTTGATAGGTGACAATAGCAGGTGTAGATTTGACTTTAGGTTCTGC
AGAGCATGAGCTTATGAGCAAACAATCAACAAAATGAGCCTACTTATTCAGACCATGATG
TATCTGAATTATGC
■■Homology search results ■■ -
sp_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916401|Adiantum capillus-veneris mRNA, clone:
YMU001_000087_C08.
(374 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done

***** No hits found ******


tr_hit_id Q9ZU99
Definition tr|Q9ZU99|Q9ZU99_ARATH Expressed protein (At2g01710/T8O11.12) OS=Arabidopsis thaliana
Align length 62
Score (bit) 33.9
E-value 4.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916401|Adiantum capillus-veneris mRNA, clone:
YMU001_000087_C08.
(374 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9ZU99|Q9ZU99_ARATH Expressed protein (At2g01710/T8O11.12) OS... 34 4.1

>tr|Q9ZU99|Q9ZU99_ARATH Expressed protein (At2g01710/T8O11.12)
OS=Arabidopsis thaliana GN=At2g01710 PE=2 SV=1
Length = 311

Score = 33.9 bits (76), Expect = 4.1
Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 1/62 (1%)
Frame = +1

Query: 31 LLQLTTM*LGKIEILFRNSPNNTYEHRP*WVTIPGV-DLTLGSA*HELMSKQSTK*AYLF 207
LL+ T L +++L ++P N +++P W I + DLT S ++L+ KQ + A L
Sbjct: 43 LLEGTDQILAVVDVLLSSAPENRIKNQPNWYKILQIEDLTESSTDNDLIKKQYRRLALLL 102

Query: 208 RP 213
P
Sbjct: 103 HP 104