BP916436
Clone id YMU001_000087_F08
Library
Length 468
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000087_F08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GTGAAAATGATCATATTTAGTACTTGCCTGTAACCATTGCATATATACACTGTTAGGACA
TTTGCTCAACTCAATGAAGCATCTTCGCAGCACGACCCTGACCTCCGAGTTATTATGTAC
AGCACACCTGAGTGGCTACCATTTTAACCACCAGAAACCAGTTCAACATCCCCCAGCAGC
TACCATTAAACCTGCAACCACTTCGACATCCACCTGGAACAAGAACTTCTGAAGGCCATG
CACTTGCGTAGCAGGAAACTCGAAGCCTTTTATATGGTACATGGCAAAGTAGCTGGCATC
GATATTTTCTGGTTCTGCAAAAACCTGTGGATTACACCAAAAGCCCTAAAGCAGGGCCAG
TCGGTAAGATAACAACGCCTCCACTCCCCATGGGCCAGTCTTTACATTACCCATTACTGA
AGATAGGTTTTCTTCTACCGTATCCTTCTTCCCCTCCAAACTTGTGCC
■■Homology search results ■■ -
sp_hit_id P40225
Definition sp|P40225|TPO_HUMAN Thrombopoietin OS=Homo sapiens
Align length 41
Score (bit) 30.8
E-value 3.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916436|Adiantum capillus-veneris mRNA, clone:
YMU001_000087_F08.
(468 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P40225|TPO_HUMAN Thrombopoietin OS=Homo sapiens GN=THPO PE=1 ... 31 3.1
sp|Q6ZRS4|CC129_HUMAN Coiled-coil domain-containing protein 129 ... 31 3.1
sp|Q98VG9|R1AB_FIPV Replicase polyprotein 1ab OS=Feline coronavi... 30 5.3
sp|Q04752|STF1_BOVIN Steroidogenic factor 1 OS=Bos taurus GN=NR5... 30 6.8
sp|Q562E2|KCD19_MOUSE BTB/POZ domain-containing protein KCTD19 O... 29 8.9
sp|P29029|CHIT_YEAST Endochitinase OS=Saccharomyces cerevisiae G... 29 8.9

>sp|P40225|TPO_HUMAN Thrombopoietin OS=Homo sapiens GN=THPO PE=1
SV=1
Length = 353

Score = 30.8 bits (68), Expect = 3.1
Identities = 17/41 (41%), Positives = 25/41 (60%)
Frame = +3

Query: 333 YTKSPKAGPVGKITTPPLPMGQSLHYPLLKIGFLLPYPSSP 455
Y+ SP P G+ T PLP +L P++++ LLP PS+P
Sbjct: 292 YSPSPTHPPTGQYTLFPLP--PTLPTPVVQLHPLLPDPSAP 330


>sp|Q6ZRS4|CC129_HUMAN Coiled-coil domain-containing protein 129
OS=Homo sapiens GN=CCDC129 PE=2 SV=1
Length = 896

Score = 30.8 bits (68), Expect = 3.1
Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 4/37 (10%)
Frame = +2

Query: 29 CNHCIYTLLGH----LLNSMKHLRSTTLTSELLCTAH 127
C HC+ +L GH + ++K L+ TT+ CT H
Sbjct: 681 CRHCLCSLTGHQEAQFMTTLKALQDTTVRELCSCTVH 717


>sp|Q98VG9|R1AB_FIPV Replicase polyprotein 1ab OS=Feline coronavirus
(strain FIPV WSU-79/1146) GN=rep PE=1 SV=2
Length = 6709

Score = 30.0 bits (66), Expect = 5.3
Identities = 12/22 (54%), Positives = 16/22 (72%)
Frame = +1

Query: 253 RKLEAFYMVHGKVAGIDIFWFC 318
R LE YMVHG++ G+ +FW C
Sbjct: 5910 RCLEYDYMVHGQMNGLMLFWNC 5931


>sp|Q04752|STF1_BOVIN Steroidogenic factor 1 OS=Bos taurus GN=NR5A1
PE=1 SV=1
Length = 461

Score = 29.6 bits (65), Expect = 6.8
Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 1/46 (2%)
Frame = +3

Query: 321 KPVDYTKSPKAGPVGKITTPPLPMG-QSLHYPLLKIGFLLPYPSSP 455
+P P AGP+G P LPM S H PL G+L YP+ P
Sbjct: 148 EPKGLASGPPAGPLGDFGAPALPMAVPSAHGPL--AGYL--YPAFP 189


>sp|Q562E2|KCD19_MOUSE BTB/POZ domain-containing protein KCTD19
OS=Mus musculus GN=Kctd19 PE=2 SV=2
Length = 927

Score = 29.3 bits (64), Expect = 8.9
Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 7/60 (11%)
Frame = +3

Query: 291 SWHRYFLVLQKPVDYT-KSPK------AGPVGKITTPPLPMGQSLHYPLLKIGFLLPYPS 449
++ R + + KP D+ KSP P+G + TP L + +HY L + + YPS
Sbjct: 128 NYWRTWKCISKPSDFPIKSPAFTGLHDKAPLGLMDTPLLDTEEEVHYCFLPLDLVAKYPS 187


>sp|P29029|CHIT_YEAST Endochitinase OS=Saccharomyces cerevisiae
GN=CTS1 PE=1 SV=2
Length = 562

Score = 29.3 bits (64), Expect = 8.9
Identities = 18/55 (32%), Positives = 26/55 (47%)
Frame = +2

Query: 47 TLLGHLLNSMKHLRSTTLTSELLCTAHLSGYHFNHQKPVQHPPAATIKPATTSTS 211
TL + SMK S+ +TS L T + P+Q +T+ PAT S+S
Sbjct: 396 TLNSVAITSMKTTLSSQITSAALVTPQTTTTSIVSSAPIQTAITSTLSPATKSSS 450


tr_hit_id A9BAT0
Definition tr|A9BAT0|A9BAT0_PROM4 Glycosyl transferase, family 2 OS=Prochlorococcus marinus (strain MIT 9211)
Align length 94
Score (bit) 34.7
E-value 2.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916436|Adiantum capillus-veneris mRNA, clone:
YMU001_000087_F08.
(468 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9BAT0|A9BAT0_PROM4 Glycosyl transferase, family 2 OS=Prochlo... 35 2.5
tr|B4MTD9|B4MTD9_DROWI GK20139 OS=Drosophila willistoni GN=GK201... 33 5.5

>tr|A9BAT0|A9BAT0_PROM4 Glycosyl transferase, family 2
OS=Prochlorococcus marinus (strain MIT 9211)
GN=P9211_10111 PE=4 SV=1
Length = 310

Score = 34.7 bits (78), Expect = 2.5
Identities = 27/94 (28%), Positives = 42/94 (44%), Gaps = 4/94 (4%)
Frame = -1

Query: 294 SYFAMYHIKGFEFPATQVHGLQKFLFQV----DVEVVAGLMVAAGGC*TGFWWLKW*PLR 127
+Y A+ + FE+P ++ H L+ F +V + ++ AAG F W L
Sbjct: 123 TYGAVINTSNFEYPTSEPHKLRDISFAYFATGNVAIDKNVLEAAGLFDPAFKLYGWEDL- 181

Query: 126 CAVHNNSEVRVVLRRCFIELSKCPNSVYMQWLQA 25
E+ LRR +EL KCP +V W +A
Sbjct: 182 -------ELGERLRRMNVELVKCPKAVGYHWHKA 208


>tr|B4MTD9|B4MTD9_DROWI GK20139 OS=Drosophila willistoni GN=GK20139
PE=4 SV=1
Length = 737

Score = 33.5 bits (75), Expect = 5.5
Identities = 15/35 (42%), Positives = 21/35 (60%)
Frame = +2

Query: 68 NSMKHLRSTTLTSELLCTAHLSGYHFNHQKPVQHP 172
+S KHL +TT +S ++ S +H HQ P QHP
Sbjct: 308 SSSKHLTTTTASSASSSSSAASHHHHQHQHPHQHP 342