BP916451
Clone id YMU001_000087_G11
Library
Length 502
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000087_G11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTCCTTTCAACACAAGAAGACTATGTTTCCTTGTTATACACATGTTATACACAACAAGGG
ACAATAACTTGATGGTAAAGTGTTGGCCTCTTACCCTCATGGGGTGGGTTCAACACTCCT
CCTTCATGCAAGGCTTAAGCGGGCCTTCCTACACGCGCAGCCAACGACGCCAACGAAAGC
CTTCAAAGCCTCAATGCCATTGAGTTTTCGATCAGTATTCCTTGGTTGCCCGTTGTGGAG
AGCGTAGATGGGGCGGTTGCGGTTGGCTGTTGCTGTCTATCCACGCGTTGCTTGCACAGA
AAACTGTGTTTGTCTTCTTTTTACTACACAGCGGAGATGTCGCTAACTGTGGAACGTGGG
AGAGAAGCAGGGCGTCGCACGCACATGCAAGCCACTTTTAGCCTCCTCCCAAAAATAGCT
CGGATACTAGTGAAAGGGCGGTGGTAATGTGTGCTAGTATCCACCAAACCGTGAAATCTT
ATAGCCTCCCACTAGCGTACAC
■■Homology search results ■■ -
sp_hit_id Q28295
Definition sp|Q28295|VWF_CANFA von Willebrand factor OS=Canis familiaris
Align length 66
Score (bit) 30.0
E-value 6.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916451|Adiantum capillus-veneris mRNA, clone:
YMU001_000087_G11.
(502 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q28295|VWF_CANFA von Willebrand factor OS=Canis familiaris GN... 30 6.4

>sp|Q28295|VWF_CANFA von Willebrand factor OS=Canis familiaris GN=VWF
PE=1 SV=2
Length = 2813

Score = 30.0 bits (66), Expect = 6.4
Identities = 18/66 (27%), Positives = 29/66 (43%)
Frame = +1

Query: 115 TPPSCKA*AGLPTRAANDANESLQSLNAIEFSISIPWLPVVESVDGAVAVGCCCLSTRCL 294
+PPSC L R +E + N + ++S P + + AV C C +T C
Sbjct: 2371 SPPSCPPHRTLALRKTQCCDEYECACNCVNSTVSCP----LGYLASAVTNDCGCTTTTCF 2426

Query: 295 HRKLCL 312
K+C+
Sbjct: 2427 PDKVCV 2432


tr_hit_id Q1QKG2
Definition tr|Q1QKG2|Q1QKG2_NITHX Putative uncharacterized protein OS=Nitrobacter hamburgensis (strain X14 / DSM 10229)
Align length 62
Score (bit) 33.9
E-value 4.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916451|Adiantum capillus-veneris mRNA, clone:
YMU001_000087_G11.
(502 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q1QKG2|Q1QKG2_NITHX Putative uncharacterized protein OS=Nitro... 34 4.5

>tr|Q1QKG2|Q1QKG2_NITHX Putative uncharacterized protein
OS=Nitrobacter hamburgensis (strain X14 / DSM 10229)
GN=Nham_2496 PE=4 SV=1
Length = 127

Score = 33.9 bits (76), Expect = 4.5
Identities = 20/62 (32%), Positives = 29/62 (46%)
Frame = -1

Query: 349 QLATSPLCSKKKTNTVFCASNAWIDSNSQPQPPHLRSPQRATKEY*SKTQWH*GFEGFRW 170
Q T+PL S + T+T + AW + + P LR+ +R Y FE +RW
Sbjct: 14 QAITAPLASDRSTSTARTVAEAWEITKGRKPAPELRNYRRDLDLY---------FEYWRW 64

Query: 169 RR 164
RR
Sbjct: 65 RR 66