BP916468
Clone id YMU001_000088_A07
Library
Length 461
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000088_A07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CATGATTCATAAACAACCAGGTAGAAACCAACCAAACATAAGCAAAGGGAGGCGAGAACT
GAGGCTGATGTGCTAAACCCCCTCAAACCGAGTACAAGAAGGGGGAAACAAACCTCCCCT
GCTGCACAGAACTGACCGATAACAGCACAACCCTTTCAGCAGAAAAACGTCAATAAATAA
AACCTTTCCATTTCTTCAAAAAGATGCTAGTAACCATAGACCTCGCAAACAGACGAACTA
CTACTCGAGGAAAGTATATACAATGCCTTTTCCTTTCCCCATTGGCCAAAACAAACTGGC
TAACCTGACCTTCAAGCAGCAAAGACCGAGCGCAAAGCTTTATCTACTGAAACGGGACAT
AACAAGATAGAATAAAACCTACTATTGAGTTGTCTTTTGCCAGCAAGCTAATGCTTTCTG
AGCCCAGTAACATTCTTCTGCAACAGCCTGCACTCAATAGA
■■Homology search results ■■ -
sp_hit_id P91699
Definition sp|P91699|DECA_DROPS Protein decapentaplegic OS=Drosophila pseudoobscura pseudoobscura
Align length 89
Score (bit) 31.2
E-value 2.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916468|Adiantum capillus-veneris mRNA, clone:
YMU001_000088_A07.
(461 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P91699|DECA_DROPS Protein decapentaplegic OS=Drosophila pseud... 31 2.2
sp|Q1KVX6|CHLN_SCEOB Light-independent protochlorophyllide reduc... 30 3.8
sp|Q5H9M0|MUML1_HUMAN MUM1-like protein 1 OS=Homo sapiens GN=MUM... 30 6.5
sp|P32495|NHP2_YEAST H/ACA ribonucleoprotein complex subunit 2 O... 29 8.5

>sp|P91699|DECA_DROPS Protein decapentaplegic OS=Drosophila
pseudoobscura pseudoobscura GN=dpp PE=2 SV=3
Length = 616

Score = 31.2 bits (69), Expect = 2.2
Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 4/89 (4%)
Frame = +2

Query: 8 HKQPGRNQPNISKGRRELRLM----C*TPSNRVQEGGNKPPLLHRTDR*QHNPFSRKTSI 175
+K N N++KG R + + +NR +KP RTD+ +++ K +
Sbjct: 91 YKNRNNNNNNLNKGPRNNKNKGNKHSKSDANRQFNEVHKP----RTDQLENSKNKPKQLV 146

Query: 176 NKTFPFLQKDASNHRPRKQTNYYSRKVYT 262
NKT KD +H+P++Q + + T
Sbjct: 147 NKTNKMAVKDQKHHQPQQQQQQHHKPATT 175


>sp|Q1KVX6|CHLN_SCEOB Light-independent protochlorophyllide
reductase subunit N OS=Scenedesmus obliquus GN=chlN PE=3
SV=1
Length = 560

Score = 30.4 bits (67), Expect = 3.8
Identities = 13/24 (54%), Positives = 17/24 (70%)
Frame = +3

Query: 135 TDNSTTLSAEKRQ*IKPFHFFKKM 206
T+NS T SAEK++ PF FFK +
Sbjct: 200 TENSKTFSAEKKKTQNPFEFFKSL 223


>sp|Q5H9M0|MUML1_HUMAN MUM1-like protein 1 OS=Homo sapiens GN=MUM1L1
PE=2 SV=1
Length = 696

Score = 29.6 bits (65), Expect = 6.5
Identities = 13/28 (46%), Positives = 17/28 (60%)
Frame = +3

Query: 78 PPQTEYKKGETNLPCCTELTDNSTTLSA 161
PP +Y+K E +LP C E +NS L A
Sbjct: 129 PPHKKYRKDEGDLPGCLEERENSACLLA 156


>sp|P32495|NHP2_YEAST H/ACA ribonucleoprotein complex subunit 2
OS=Saccharomyces cerevisiae GN=NHP2 PE=1 SV=2
Length = 156

Score = 29.3 bits (64), Expect = 8.5
Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 4/58 (6%)
Frame = +2

Query: 200 KDASNHRPRKQT----NYYSRKVYTMPFPFPIGQNKLANLTFKQQRPSAKLYLLKRDI 361
KD H+ K++ NY +R +PF P+ KL K + ++K +KR +
Sbjct: 3 KDNKEHKESKESKTVDNYEARMPAVLPFAKPLASKKLNKKVLKTVKKASKAKNVKRGV 60


tr_hit_id Q23H19
Definition tr|Q23H19|Q23H19_TETTH Putative uncharacterized protein OS=Tetrahymena thermophila SB210
Align length 60
Score (bit) 33.9
E-value 4.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916468|Adiantum capillus-veneris mRNA, clone:
YMU001_000088_A07.
(461 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q23H19|Q23H19_TETTH Putative uncharacterized protein OS=Tetra... 34 4.1
tr|B3LBX7|B3LBX7_PLAKH Inositol polyphosphate kinase, putative O... 33 5.4
tr|Q814R4|Q814R4_BACCR Collagen adhesion protein OS=Bacillus cer... 33 9.2
tr|B7HFQ5|B7HFQ5_BACCE Lpxtg-motif cell wall anchor domain prote... 33 9.2
tr|B5UQF3|B5UQF3_BACCE Lpxtg-motif cell wall anchor domain prote... 33 9.2
tr|B4MRN9|B4MRN9_DROWI GK15714 OS=Drosophila willistoni GN=GK157... 33 9.2

>tr|Q23H19|Q23H19_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_00878220 PE=4
SV=1
Length = 597

Score = 33.9 bits (76), Expect = 4.1
Identities = 18/60 (30%), Positives = 33/60 (55%)
Frame = +2

Query: 206 ASNHRPRKQTNYYSRKVYTMPFPFPIGQNKLANLTFKQQRPSAKLYLLKRDITR*NKTYY 385
++++R KQT K+ FP QNK N+ F Q+ ++K+Y+ + + N+T+Y
Sbjct: 400 STDYRDSKQTKIALNKINQTKIEFP--QNKYGNIIFNQKIDNSKVYIFRFKL---NRTFY 454


>tr|B3LBX7|B3LBX7_PLAKH Inositol polyphosphate kinase, putative
OS=Plasmodium knowlesi (strain H) GN=PKH_141540 PE=4
SV=1
Length = 1315

Score = 33.5 bits (75), Expect = 5.4
Identities = 20/57 (35%), Positives = 30/57 (52%)
Frame = +2

Query: 2 MIHKQPGRNQPNISKGRRELRLMC*TPSNRVQEGGNKPPLLHRTDR*QHNPFSRKTS 172
++ KQ RN+PN SKGR+ L +++ E + P RTD+ P SR+ S
Sbjct: 83 LVRKQKRRNEPNSSKGRKYFSLEERDKKDKLDEQPSNEPTSQRTDQSAKEP-SREPS 138


>tr|Q814R4|Q814R4_BACCR Collagen adhesion protein OS=Bacillus cereus
(strain ATCC 14579 / DSM 31) GN=BC_5358 PE=4 SV=1
Length = 2000

Score = 32.7 bits (73), Expect = 9.2
Identities = 20/57 (35%), Positives = 24/57 (42%)
Frame = +2

Query: 227 KQTNYYSRKVYTMPFPFPIGQNKLANLTFKQQRPSAKLYLLKRDITR*NKTYY*VVF 397
K YY V + F GQ KL LTFK K+ L+K D +K VF
Sbjct: 660 KAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSKALAGAVF 716


>tr|B7HFQ5|B7HFQ5_BACCE Lpxtg-motif cell wall anchor domain protein
OS=Bacillus cereus B4264 GN=BCB4264_A5480 PE=4 SV=1
Length = 3210

Score = 32.7 bits (73), Expect = 9.2
Identities = 20/57 (35%), Positives = 24/57 (42%)
Frame = +2

Query: 227 KQTNYYSRKVYTMPFPFPIGQNKLANLTFKQQRPSAKLYLLKRDITR*NKTYY*VVF 397
K YY V + F GQ KL LTFK K+ L+K D +K VF
Sbjct: 1777 KAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSKALAGAVF 1833


>tr|B5UQF3|B5UQF3_BACCE Lpxtg-motif cell wall anchor domain protein
OS=Bacillus cereus AH1134 GN=BCAH1134_5453 PE=4 SV=1
Length = 2852

Score = 32.7 bits (73), Expect = 9.2
Identities = 20/57 (35%), Positives = 24/57 (42%)
Frame = +2

Query: 227 KQTNYYSRKVYTMPFPFPIGQNKLANLTFKQQRPSAKLYLLKRDITR*NKTYY*VVF 397
K YY V + F GQ KL LTFK K+ L+K D +K VF
Sbjct: 1777 KAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSKALAGAVF 1833


>tr|B4MRN9|B4MRN9_DROWI GK15714 OS=Drosophila willistoni GN=GK15714
PE=4 SV=1
Length = 1503

Score = 32.7 bits (73), Expect = 9.2
Identities = 21/54 (38%), Positives = 27/54 (50%)
Frame = +2

Query: 179 KTFPFLQKDASNHRPRKQTNYYSRKVYTMPFPFPIGQNKLANLTFKQQRPSAKL 340
K PFLQK N +Q S+ T+P P Q + + T+KQQ PS KL
Sbjct: 1225 KKAPFLQKAKDNRSALRQRREQSK--ITVPQKAPPKQEQDLSRTWKQQHPSGKL 1276