BP916518
Clone id YMU001_000088_E11
Library
Length 558
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000088_E11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AAAACTTATCAGTTGCATCTGACAAGAAGATTTCAACGAGATTGTACAGAAAGAGCTTAT
CAAGCCTGAGTTATCTAAGAGATAGGACGTTACGATTGCAGCTAGCACAAGACAACGTAA
TTGAATTGGAGGACTCCAATGTTGGTCTTCTGGATGCAGTTAATGCAAATGACTCTTTTT
CTTGTGAGGATGTGCAAGGAGGATCGATCAGCGAGATGTTCAGTGAAGGAAATCGAAGCA
TAAGCACAGCCCCTTGTGAAGATTCTCACTCTCTGTTTGATGGAATCAAAGCGTCTGCAT
TAGTATATACTTGCAACTCGGCGTCGAGCTTCCCTGTGTTGTCACAAGCGGCCAACCCGA
AGCTCAGAATGAAATTTCAACACCAATGGCAGCCTACAAGATTGACTGATTGTAATGTGA
AGTTCGGCAAGGCAGCTTGATCTATGAGTTGGAAAGAATGGTGCTGAACTTTGTACATAA
TCCTATGGGTAGCTTGATAATGAGTTGAATGCGAGCGTTGCCGAATTGTATTGGCTAGCT
TGGTACGAGTCGAAGGAA
■■Homology search results ■■ -
sp_hit_id Q08490
Definition sp|Q08490|SGO1_YEAST Shugoshin OS=Saccharomyces cerevisiae
Align length 73
Score (bit) 31.2
E-value 3.6
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916518|Adiantum capillus-veneris mRNA, clone:
YMU001_000088_E11.
(558 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q08490|SGO1_YEAST Shugoshin OS=Saccharomyces cerevisiae GN=SG... 31 3.6
sp|Q7VMC9|SYM_HAEDU Methionyl-tRNA synthetase OS=Haemophilus duc... 30 8.0

>sp|Q08490|SGO1_YEAST Shugoshin OS=Saccharomyces cerevisiae GN=SGO1
PE=1 SV=1
Length = 590

Score = 31.2 bits (69), Expect = 3.6
Identities = 17/73 (23%), Positives = 32/73 (43%)
Frame = +3

Query: 186 EDVQGGSISEMFSEGNRSISTAPCEDSHSLFDGIKASALVYTCNSASSFPVLSQAANPKL 365
E S E+F++ +ST P G A+ T ++++ +P S + N
Sbjct: 269 EPEHSSSKLEIFNDSTNMLSTVPSNPLPLPLPGPSATLPTTTSDASTVYPSSSSSTNSHP 328

Query: 366 RMKFQHQWQPTRL 404
+ K +H +P R+
Sbjct: 329 KTKIKHSMKPPRI 341


>sp|Q7VMC9|SYM_HAEDU Methionyl-tRNA synthetase OS=Haemophilus
ducreyi GN=metG PE=3 SV=1
Length = 684

Score = 30.0 bits (66), Expect = 8.0
Identities = 18/58 (31%), Positives = 24/58 (41%)
Frame = -2

Query: 551 DSYQASQYNSATLAFNSLSSYP*DYVQSSAPFFPTHRSSCLAELHITISQSCRLPLVL 378
D Y+A +YN A L YV AP+ ++ AELH S L +L
Sbjct: 428 DHYEAREYNKAIRLIMDLCDKANKYVDDKAPWVIAKQADREAELHAVCSMGIELFRIL 485


tr_hit_id A7UZE1
Definition tr|A7UZE1|A7UZE1_BACUN Putative uncharacterized protein OS=Bacteroides uniformis ATCC 8492
Align length 47
Score (bit) 36.2
E-value 1.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916518|Adiantum capillus-veneris mRNA, clone:
YMU001_000088_E11.
(558 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7UZE1|A7UZE1_BACUN Putative uncharacterized protein OS=Bacte... 36 1.2
tr|A6WZU7|A6WZU7_OCHA4 Putative uncharacterized protein OS=Ochro... 35 2.1

>tr|A7UZE1|A7UZE1_BACUN Putative uncharacterized protein
OS=Bacteroides uniformis ATCC 8492 GN=BACUNI_00668 PE=4
SV=1
Length = 498

Score = 36.2 bits (82), Expect = 1.2
Identities = 17/47 (36%), Positives = 25/47 (53%)
Frame = -2

Query: 257 TRGCAYASISFTEHLADRSSLHILTRKRVICINCIQKTNIGVLQFNY 117
+R C A I+F EH D S + V+C+NCI+K G + + Y
Sbjct: 234 SRNCKAACINFKEHQIDAS-------RCVVCMNCIEKCKHGAISYKY 273


>tr|A6WZU7|A6WZU7_OCHA4 Putative uncharacterized protein
OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 /
NCTC 12168) GN=Oant_1785 PE=4 SV=1
Length = 591

Score = 35.4 bits (80), Expect = 2.1
Identities = 20/78 (25%), Positives = 40/78 (51%)
Frame = +3

Query: 111 DNVIELEDSNVGLLDAVNANDSFSCEDVQGGSISEMFSEGNRSISTAPCEDSHSLFDGIK 290
DN + L ++ V DAVN + S G +E+F++G R+++ C ++ G+
Sbjct: 236 DNPVILRNAVVNFYDAVNRGEQPS------GQAAEVFAQGERALAERLCRNAGIATIGLS 289

Query: 291 ASALVYTCNSASSFPVLS 344
+ +V + S FP+++
Sbjct: 290 DAEVVRRAATTSDFPLIA 307