BP916526
Clone id YMU001_000088_F07
Library
Length 512
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000088_F07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTTTTTGAGCACCAACTAAAAATTCTCATTGAAGGCCGCTTGGAATAAAACTAGAAGCTA
AAAGCTCCTACTTTACCAGTGACATAACAAAATGAGCTTGTTAGGAAGAACATAAGGTAC
CAAAGTTAGGCCAGCAGATACATCATGGCCTACCCCGTATATATCCCATGAATACATGGA
AAACCCACATATCAAGAGCCACCACACTCATGAGTTCACAAAATTCTCAAAATCTATCTG
ACAGCCACAATGTCATCGATCTTCAATATCATTCGAACACACTCGGTAGCAAGAGAAACA
GCACTGGTGCTCACTAAGAGAGGTTGCACTACATTCTCCTCCAGCATGTTTGTTATTTGA
CCCTTTCTCACATTAATGCCAGCATTTGCTTGCCCATTAGCATGATGATTGCGAAGTTCA
GTCACAATAGCAATGGGGTTAAGCCCTGCATTCTCAGCCAAAGTATATGGAATGACTTCC
AAAGCCTCTGCAAAAGCCTTTACACAGTAACT
■■Homology search results ■■ -
sp_hit_id Q54CL2
Definition sp|Q54CL2|TCPD_DICDI T-complex protein 1 subunit delta OS=Dictyostelium discoideum
Align length 92
Score (bit) 144.0
E-value 2.0e-34
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916526|Adiantum capillus-veneris mRNA, clone:
YMU001_000088_F07.
(512 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q54CL2|TCPD_DICDI T-complex protein 1 subunit delta OS=Dictyo... 144 2e-34
sp|Q9NB32|TCPD_AEDTR T-complex protein 1 subunit delta OS=Aedes ... 135 8e-32
sp|Q5R637|TCPD_PONAB T-complex protein 1 subunit delta OS=Pongo ... 135 1e-31
sp|P50991|TCPD_HUMAN T-complex protein 1 subunit delta OS=Homo s... 135 1e-31
sp|Q2T9X2|TCPD_BOVIN T-complex protein 1 subunit delta OS=Bos ta... 134 2e-31
sp|Q7TPB1|TCPD_RAT T-complex protein 1 subunit delta OS=Rattus n... 134 2e-31
sp|P80315|TCPD_MOUSE T-complex protein 1 subunit delta OS=Mus mu... 134 2e-31
sp|P47208|TCPD_CAEEL T-complex protein 1 subunit delta OS=Caenor... 132 1e-30
sp|P53451|TCPD_FUGRU T-complex protein 1 subunit delta OS=Fugu r... 130 5e-30
sp|P50999|TCPD_SCHPO T-complex protein 1 subunit delta OS=Schizo... 127 2e-29
sp|Q6BXF6|TCPD_DEBHA T-complex protein 1 subunit delta OS=Debary... 113 6e-25
sp|Q6FQT2|TCPD_CANGA T-complex protein 1 subunit delta OS=Candid... 113 6e-25
sp|Q75A36|TCPD_ASHGO T-complex protein 1 subunit delta OS=Ashbya... 112 1e-24
sp|P39078|TCPD_YEAST T-complex protein 1 subunit delta OS=Saccha... 110 3e-24
sp|Q6CL82|TCPD_KLULA T-complex protein 1 subunit delta OS=Kluyve... 107 2e-23
sp|P50016|THS_METKA Thermosome subunit OS=Methanopyrus kandleri ... 103 4e-22
sp|Q6C100|TCPD_YARLI T-complex protein 1 subunit delta OS=Yarrow... 102 8e-22
sp|O28821|THSB_ARCFU Thermosome subunit beta OS=Archaeoglobus fu... 94 3e-19
sp|O30561|THS1_HALVO Thermosome subunit 1 OS=Halobacterium volca... 94 3e-19
sp|O93624|THS_METTL Thermosome subunit OS=Methanococcus thermoli... 92 2e-18
sp|Q9HN70|THSA_HALSA Thermosome subunit alpha OS=Halobacterium s... 91 3e-18
sp|O28045|THSA_ARCFU Thermosome subunit alpha OS=Archaeoglobus f... 90 7e-18
sp|Q58405|THS_METJA Thermosome subunit OS=Methanocaldococcus jan... 89 2e-17
sp|P48425|THSB_THEAC Thermosome subunit beta OS=Thermoplasma aci... 88 3e-17
sp|P48424|THSA_THEAC Thermosome subunit alpha OS=Thermoplasma ac... 80 6e-15
sp|Q9V2Q7|THS_PYRAB Thermosome subunit OS=Pyrococcus abyssi GN=t... 79 9e-15
sp|O57762|THS_PYRHO Thermosome subunit OS=Pyrococcus horikoshii ... 79 1e-14
sp|P61112|THSA_THEK1 Thermosome subunit alpha OS=Thermococcus sp... 79 2e-14
sp|P61111|THSA_PYRKO Thermosome subunit alpha OS=Pyrococcus koda... 79 2e-14
sp|O30560|THS2_HALVO Thermosome subunit 2 OS=Halobacterium volca... 79 2e-14

>sp|Q54CL2|TCPD_DICDI T-complex protein 1 subunit delta
OS=Dictyostelium discoideum GN=cct4 PE=3 SV=1
Length = 533

Score = 144 bits (363), Expect = 2e-34
Identities = 71/92 (77%), Positives = 83/92 (90%)
Frame = -1

Query: 512 SYCVKAFAEALEVIPYTLAENAGLNPIAIVTELRNHHANGQANAGINVRKGQITNMLEEN 333
SYCV+A+AEALE+IPYTLAENAGL+PI+IVTELRN HA G+ N+GINVRKG ITN+L+EN
Sbjct: 442 SYCVRAYAEALEIIPYTLAENAGLHPISIVTELRNKHAQGEINSGINVRKGAITNILQEN 501

Query: 332 VVQPLLVSTSAVSLATECVRMILKIDDIVAVR 237
VVQPLLVSTSA++LATE V M+LKIDDI R
Sbjct: 502 VVQPLLVSTSALTLATETVVMLLKIDDIATAR 533


>sp|Q9NB32|TCPD_AEDTR T-complex protein 1 subunit delta OS=Aedes
triseriatus PE=2 SV=1
Length = 533

Score = 135 bits (341), Expect = 8e-32
Identities = 68/89 (76%), Positives = 78/89 (87%)
Frame = -1

Query: 512 SYCVKAFAEALEVIPYTLAENAGLNPIAIVTELRNHHANGQANAGINVRKGQITNMLEEN 333
+YC +AFA ALEVIP TLAENAGLNPIA VTELRN HA G+ NAGINVRKG IT++L EN
Sbjct: 441 AYCFRAFANALEVIPSTLAENAGLNPIATVTELRNRHAQGEKNAGINVRKGAITDILAEN 500

Query: 332 VVQPLLVSTSAVSLATECVRMILKIDDIV 246
VVQPLLVSTS+++LA+E VR ILKIDDI+
Sbjct: 501 VVQPLLVSTSSITLASETVRSILKIDDII 529


>sp|Q5R637|TCPD_PONAB T-complex protein 1 subunit delta OS=Pongo
abelii GN=CCT4 PE=2 SV=3
Length = 539

Score = 135 bits (340), Expect = 1e-31
Identities = 69/92 (75%), Positives = 79/92 (85%)
Frame = -1

Query: 512 SYCVKAFAEALEVIPYTLAENAGLNPIAIVTELRNHHANGQANAGINVRKGQITNMLEEN 333
SYCV+AFA+A+EVIP TLAENAGLNPI+ VTELRN HA G+ AGINVRKG I+N+LEE
Sbjct: 448 SYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEEL 507

Query: 332 VVQPLLVSTSAVSLATECVRMILKIDDIVAVR 237
VVQPLLVS SA++LATE VR ILKIDD+V R
Sbjct: 508 VVQPLLVSVSALTLATETVRSILKIDDVVNTR 539


>sp|P50991|TCPD_HUMAN T-complex protein 1 subunit delta OS=Homo
sapiens GN=CCT4 PE=1 SV=4
Length = 539

Score = 135 bits (340), Expect = 1e-31
Identities = 69/92 (75%), Positives = 79/92 (85%)
Frame = -1

Query: 512 SYCVKAFAEALEVIPYTLAENAGLNPIAIVTELRNHHANGQANAGINVRKGQITNMLEEN 333
SYCV+AFA+A+EVIP TLAENAGLNPI+ VTELRN HA G+ AGINVRKG I+N+LEE
Sbjct: 448 SYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEEL 507

Query: 332 VVQPLLVSTSAVSLATECVRMILKIDDIVAVR 237
VVQPLLVS SA++LATE VR ILKIDD+V R
Sbjct: 508 VVQPLLVSVSALTLATETVRSILKIDDVVNTR 539


>sp|Q2T9X2|TCPD_BOVIN T-complex protein 1 subunit delta OS=Bos
taurus GN=CCT4 PE=2 SV=3
Length = 542

Score = 134 bits (338), Expect = 2e-31
Identities = 67/92 (72%), Positives = 78/92 (84%)
Frame = -1

Query: 512 SYCVKAFAEALEVIPYTLAENAGLNPIAIVTELRNHHANGQANAGINVRKGQITNMLEEN 333
SYC++AFA+A+EVIP TLAENAGLNPI+ VTELRN HA G+ GINVRKG I+N+LEE
Sbjct: 451 SYCIRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTTGINVRKGGISNILEEQ 510

Query: 332 VVQPLLVSTSAVSLATECVRMILKIDDIVAVR 237
VVQPLLVS SA++LATE VR ILKIDD+V R
Sbjct: 511 VVQPLLVSVSALTLATETVRSILKIDDVVNTR 542


>sp|Q7TPB1|TCPD_RAT T-complex protein 1 subunit delta OS=Rattus
norvegicus GN=Cct4 PE=1 SV=3
Length = 539

Score = 134 bits (337), Expect = 2e-31
Identities = 68/92 (73%), Positives = 78/92 (84%)
Frame = -1

Query: 512 SYCVKAFAEALEVIPYTLAENAGLNPIAIVTELRNHHANGQANAGINVRKGQITNMLEEN 333
SYCV+AFA+A+EVIP TLAENAGLNPI+ VTELRN HA G+ GINVRKG I+N+LEE
Sbjct: 448 SYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTTGINVRKGGISNILEEM 507

Query: 332 VVQPLLVSTSAVSLATECVRMILKIDDIVAVR 237
VVQPLLVS SA++LATE VR ILKIDD+V R
Sbjct: 508 VVQPLLVSVSALTLATETVRSILKIDDVVNTR 539


>sp|P80315|TCPD_MOUSE T-complex protein 1 subunit delta OS=Mus
musculus GN=Cct4 PE=1 SV=3
Length = 539

Score = 134 bits (337), Expect = 2e-31
Identities = 68/92 (73%), Positives = 78/92 (84%)
Frame = -1

Query: 512 SYCVKAFAEALEVIPYTLAENAGLNPIAIVTELRNHHANGQANAGINVRKGQITNMLEEN 333
SYCV+AFA+A+EVIP TLAENAGLNPI+ VTELRN HA G+ GINVRKG I+N+LEE
Sbjct: 448 SYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTTGINVRKGGISNILEEM 507

Query: 332 VVQPLLVSTSAVSLATECVRMILKIDDIVAVR 237
VVQPLLVS SA++LATE VR ILKIDD+V R
Sbjct: 508 VVQPLLVSVSALTLATETVRSILKIDDVVNTR 539


>sp|P47208|TCPD_CAEEL T-complex protein 1 subunit delta
OS=Caenorhabditis elegans GN=cct-4 PE=2 SV=1
Length = 540

Score = 132 bits (331), Expect = 1e-30
Identities = 66/92 (71%), Positives = 81/92 (88%), Gaps = 1/92 (1%)
Frame = -1

Query: 509 YCVKAFAEALEVIPYTLAENAGLNPIAIVTELRNHHANGQANAGINVRKGQITNMLEENV 330
YC +AFA+ALE+IPYTLAENAGL+PI VTELRN+HANG ++ G+NVRKG +T+M+EE+V
Sbjct: 449 YCWRAFADALELIPYTLAENAGLSPIHTVTELRNNHANGNSSYGVNVRKGYVTDMVEEDV 508

Query: 329 VQPLLVSTSAVSLATECVRMILKIDDIV-AVR 237
VQPLLV+ SA+ A+ECVR ILKIDDIV AVR
Sbjct: 509 VQPLLVTASAIKQASECVRSILKIDDIVMAVR 540


>sp|P53451|TCPD_FUGRU T-complex protein 1 subunit delta OS=Fugu
rubripes GN=cct4 PE=2 SV=1
Length = 536

Score = 130 bits (326), Expect = 5e-30
Identities = 66/92 (71%), Positives = 78/92 (84%)
Frame = -1

Query: 512 SYCVKAFAEALEVIPYTLAENAGLNPIAIVTELRNHHANGQANAGINVRKGQITNMLEEN 333
+YCV+A+++ALEVIP TLAENAGLNPI+ VTELRN HA G AGINVRKG I+N++EE
Sbjct: 445 AYCVRAYSDALEVIPSTLAENAGLNPISTVTELRNRHAQGDKMAGINVRKGGISNIMEEL 504

Query: 332 VVQPLLVSTSAVSLATECVRMILKIDDIVAVR 237
VVQPLLVS SA++LATE VR ILKIDD+V R
Sbjct: 505 VVQPLLVSISALTLATETVRSILKIDDVVNAR 536


>sp|P50999|TCPD_SCHPO T-complex protein 1 subunit delta
OS=Schizosaccharomyces pombe GN=cct4 PE=2 SV=2
Length = 527

Score = 127 bits (320), Expect = 2e-29
Identities = 61/90 (67%), Positives = 75/90 (83%)
Frame = -1

Query: 506 CVKAFAEALEVIPYTLAENAGLNPIAIVTELRNHHANGQANAGINVRKGQITNMLEENVV 327
C++AF+EALE+IP TLAENAGLN I +VTELR+ HANG+ AGINVRKG +TN+LEENV+
Sbjct: 438 CIRAFSEALEIIPVTLAENAGLNAIQVVTELRSRHANGEKTAGINVRKGIVTNILEENVL 497

Query: 326 QPLLVSTSAVSLATECVRMILKIDDIVAVR 237
QPLLV+ SA+ LA E +MI+KIDDI R
Sbjct: 498 QPLLVNISAIQLAAETTKMIMKIDDITLAR 527


tr_hit_id A7VJA5
Definition tr|A7VJA5|A7VJA5_SOYBN Group II-chaperonin delta-subunit (Cytosolic chaperonin) OS=Glycine max
Align length 91
Score (bit) 164.0
E-value 3.0e-39
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916526|Adiantum capillus-veneris mRNA, clone:
YMU001_000088_F07.
(512 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7VJA5|A7VJA5_SOYBN Group II-chaperonin delta-subunit (Cytoso... 164 3e-39
tr|Q9LV21|Q9LV21_ARATH T-complex protein 1, delta subunit OS=Ara... 163 4e-39
tr|Q8L994|Q8L994_ARATH T-complex protein 1, delta subunit OS=Ara... 163 4e-39
tr|A9THX5|A9THX5_PHYPA T-complex protein 1, delta subunit OS=Phy... 163 4e-39
tr|Q70EL6|Q70EL6_SOYBN Cytosolic chaperonin delta-subunit OS=Gly... 163 5e-39
tr|A7PH02|A7PH02_VITVI T-complex protein 1, delta subunit OS=Vit... 163 5e-39
tr|A5B989|A5B989_VITVI T-complex protein 1, delta subunit OS=Vit... 163 5e-39
tr|A5BWI0|A5BWI0_VITVI T-complex protein 1, delta subunit OS=Vit... 162 7e-39
tr|Q4U3F0|Q4U3F0_IPOBA Putative cytosolic chaperonin delta subun... 162 9e-39
tr|A9T431|A9T431_PHYPA T-complex protein 1, delta subunit OS=Phy... 161 2e-38
tr|Q9ZRX1|Q9ZRX1_SOYBN T-complex protein 1, delta subunit OS=Gly... 161 2e-38
tr|Q6YUK5|Q6YUK5_ORYSJ T-complex protein 1, delta subunit OS=Ory... 160 3e-38
tr|A3BIP9|A3BIP9_ORYSJ T-complex protein 1, delta subunit OS=Ory... 160 3e-38
tr|A2YUU5|A2YUU5_ORYSI T-complex protein 1, delta subunit OS=Ory... 160 3e-38
tr|B4F8V9|B4F8V9_MAIZE Putative uncharacterized protein OS=Zea m... 159 6e-38
tr|A2Z9B2|A2Z9B2_ORYSI T-complex protein 1, delta subunit OS=Ory... 155 1e-36
tr|Q9FW88|Q9FW88_ORYSJ T-complex protein 1, delta subunit OS=Ory... 155 1e-36
tr|A3C6G2|A3C6G2_ORYSJ Putative uncharacterized protein OS=Oryza... 155 1e-36
tr|A8JE04|A8JE04_CHLRE T-complex protein 1, delta subunit (Fragm... 148 1e-34
tr|A7T288|A7T288_NEMVE T-complex protein 1, delta subunit OS=Nem... 146 7e-34
tr|B3SAB2|B3SAB2_TRIAD Putative uncharacterized protein OS=Trich... 145 1e-33
tr|Q8T5T6|Q8T5T6_PHYPO T-complex protein 1, delta subunit OS=Phy... 144 3e-33
tr|B6LL78|B6LL78_BRAFL Putative uncharacterized protein OS=Branc... 142 7e-33
tr|Q38CD4|Q38CD4_9TRYP T-complex protein 1, delta subunit OS=Try... 141 2e-32
tr|Q4DTP9|Q4DTP9_TRYCR T-complex protein 1, delta subunit OS=Try... 140 4e-32
tr|A4RYI0|A4RYI0_OSTLU T-complex protein 1, delta subunit OS=Ost... 140 5e-32
tr|Q017N8|Q017N8_OSTTA T-complex protein 1, delta subunit OS=Ost... 138 1e-31
tr|B4MWN7|B4MWN7_DROWI GK14617 OS=Drosophila willistoni GN=GK146... 137 4e-31
tr|B4MDL7|B4MDL7_DROVI GJ16148 OS=Drosophila virilis GN=GJ16148 ... 136 5e-31
tr|B4KIN7|B4KIN7_DROMO GI17110 OS=Drosophila mojavensis GN=GI171... 136 5e-31

>tr|A7VJA5|A7VJA5_SOYBN Group II-chaperonin delta-subunit (Cytosolic
chaperonin) OS=Glycine max GN=cct-d PE=2 SV=1
Length = 533

Score = 164 bits (414), Expect = 3e-39
Identities = 82/91 (90%), Positives = 87/91 (95%)
Frame = -1

Query: 509 YCVKAFAEALEVIPYTLAENAGLNPIAIVTELRNHHANGQANAGINVRKGQITNMLEENV 330
YCV+AFAEALEVIPYTLAENAGLNPIAIVTELRN HA G+ NAGINVRKGQITN+LEENV
Sbjct: 443 YCVRAFAEALEVIPYTLAENAGLNPIAIVTELRNRHAQGEINAGINVRKGQITNILEENV 502

Query: 329 VQPLLVSTSAVSLATECVRMILKIDDIVAVR 237
VQPLLVSTSA++LATECVRMILKIDDIV VR
Sbjct: 503 VQPLLVSTSAITLATECVRMILKIDDIVTVR 533


>tr|Q9LV21|Q9LV21_ARATH T-complex protein 1, delta subunit
OS=Arabidopsis thaliana GN=At3g18190 PE=2 SV=1
Length = 536

Score = 163 bits (413), Expect = 4e-39
Identities = 82/91 (90%), Positives = 87/91 (95%)
Frame = -1

Query: 509 YCVKAFAEALEVIPYTLAENAGLNPIAIVTELRNHHANGQANAGINVRKGQITNMLEENV 330
YCVK+FAEALEVIPYTLAENAGLNPIAIVTELRN HA G+ NAGINVRKGQITN+LEENV
Sbjct: 446 YCVKSFAEALEVIPYTLAENAGLNPIAIVTELRNKHAQGEINAGINVRKGQITNILEENV 505

Query: 329 VQPLLVSTSAVSLATECVRMILKIDDIVAVR 237
VQPLLVSTSA++LATECVRMILKIDDIV VR
Sbjct: 506 VQPLLVSTSAITLATECVRMILKIDDIVTVR 536


>tr|Q8L994|Q8L994_ARATH T-complex protein 1, delta subunit
OS=Arabidopsis thaliana PE=2 SV=1
Length = 536

Score = 163 bits (413), Expect = 4e-39
Identities = 82/91 (90%), Positives = 87/91 (95%)
Frame = -1

Query: 509 YCVKAFAEALEVIPYTLAENAGLNPIAIVTELRNHHANGQANAGINVRKGQITNMLEENV 330
YCVK+FAEALEVIPYTLAENAGLNPIAIVTELRN HA G+ NAGINVRKGQITN+LEENV
Sbjct: 446 YCVKSFAEALEVIPYTLAENAGLNPIAIVTELRNKHAQGEINAGINVRKGQITNILEENV 505

Query: 329 VQPLLVSTSAVSLATECVRMILKIDDIVAVR 237
VQPLLVSTSA++LATECVRMILKIDDIV VR
Sbjct: 506 VQPLLVSTSAITLATECVRMILKIDDIVTVR 536


>tr|A9THX5|A9THX5_PHYPA T-complex protein 1, delta subunit
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_92982 PE=3 SV=1
Length = 518

Score = 163 bits (413), Expect = 4e-39
Identities = 80/92 (86%), Positives = 89/92 (96%)
Frame = -1

Query: 512 SYCVKAFAEALEVIPYTLAENAGLNPIAIVTELRNHHANGQANAGINVRKGQITNMLEEN 333
SYCV++FA+A+EVIP+TLAENAGLNPIAIVTELRN HANG+AN GINVRKGQITN+LEEN
Sbjct: 427 SYCVRSFADAMEVIPFTLAENAGLNPIAIVTELRNRHANGEANTGINVRKGQITNILEEN 486

Query: 332 VVQPLLVSTSAVSLATECVRMILKIDDIVAVR 237
VVQPLLVSTSA+SLATECVRMILKIDDIV+ R
Sbjct: 487 VVQPLLVSTSAISLATECVRMILKIDDIVSTR 518


>tr|Q70EL6|Q70EL6_SOYBN Cytosolic chaperonin delta-subunit
OS=Glycine max GN=cctd PE=4 SV=1
Length = 533

Score = 163 bits (412), Expect = 5e-39
Identities = 82/91 (90%), Positives = 86/91 (94%)
Frame = -1

Query: 509 YCVKAFAEALEVIPYTLAENAGLNPIAIVTELRNHHANGQANAGINVRKGQITNMLEENV 330
YCV+AFAEALEVIPYTLAENAGLNPIAIVTELRN HA G+ NAGINVRKGQITN+LEENV
Sbjct: 443 YCVRAFAEALEVIPYTLAENAGLNPIAIVTELRNRHAQGEINAGINVRKGQITNILEENV 502

Query: 329 VQPLLVSTSAVSLATECVRMILKIDDIVAVR 237
VQPLLVSTSA+ LATECVRMILKIDDIV VR
Sbjct: 503 VQPLLVSTSAIMLATECVRMILKIDDIVTVR 533


>tr|A7PH02|A7PH02_VITVI T-complex protein 1, delta subunit OS=Vitis
vinifera GN=GSVIVT00017754001 PE=3 SV=1
Length = 533

Score = 163 bits (412), Expect = 5e-39
Identities = 81/92 (88%), Positives = 88/92 (95%)
Frame = -1

Query: 512 SYCVKAFAEALEVIPYTLAENAGLNPIAIVTELRNHHANGQANAGINVRKGQITNMLEEN 333
SYCV++FAEALEVIPYTLAENAGLNPI+IVTELRN HA G+ NAGINVRKGQITN+LEEN
Sbjct: 442 SYCVRSFAEALEVIPYTLAENAGLNPISIVTELRNRHAQGEINAGINVRKGQITNILEEN 501

Query: 332 VVQPLLVSTSAVSLATECVRMILKIDDIVAVR 237
VVQPLLVSTSA++LATECVRMILKIDDIV VR
Sbjct: 502 VVQPLLVSTSAITLATECVRMILKIDDIVTVR 533


>tr|A5B989|A5B989_VITVI T-complex protein 1, delta subunit OS=Vitis
vinifera GN=VITISV_038363 PE=3 SV=1
Length = 533

Score = 163 bits (412), Expect = 5e-39
Identities = 81/92 (88%), Positives = 88/92 (95%)
Frame = -1

Query: 512 SYCVKAFAEALEVIPYTLAENAGLNPIAIVTELRNHHANGQANAGINVRKGQITNMLEEN 333
SYCV++FAEALEVIPYTLAENAGLNPI+IVTELRN HA G+ NAGINVRKGQITN+LEEN
Sbjct: 442 SYCVRSFAEALEVIPYTLAENAGLNPISIVTELRNRHAQGEINAGINVRKGQITNILEEN 501

Query: 332 VVQPLLVSTSAVSLATECVRMILKIDDIVAVR 237
VVQPLLVSTSA++LATECVRMILKIDDIV VR
Sbjct: 502 VVQPLLVSTSAITLATECVRMILKIDDIVTVR 533


>tr|A5BWI0|A5BWI0_VITVI T-complex protein 1, delta subunit OS=Vitis
vinifera GN=VITISV_008621 PE=3 SV=1
Length = 533

Score = 162 bits (411), Expect = 7e-39
Identities = 80/92 (86%), Positives = 88/92 (95%)
Frame = -1

Query: 512 SYCVKAFAEALEVIPYTLAENAGLNPIAIVTELRNHHANGQANAGINVRKGQITNMLEEN 333
SYC+++FAEALEVIPYTLAENAGLNPI+IVTELRN HA G+ NAGINVRKGQITN+LEEN
Sbjct: 442 SYCIRSFAEALEVIPYTLAENAGLNPISIVTELRNRHAQGEINAGINVRKGQITNILEEN 501

Query: 332 VVQPLLVSTSAVSLATECVRMILKIDDIVAVR 237
VVQPLLVSTSA++LATECVRMILKIDDIV VR
Sbjct: 502 VVQPLLVSTSAITLATECVRMILKIDDIVTVR 533


>tr|Q4U3F0|Q4U3F0_IPOBA Putative cytosolic chaperonin delta subunit
(Fragment) OS=Ipomoea batatas PE=2 SV=1
Length = 170

Score = 162 bits (410), Expect = 9e-39
Identities = 81/91 (89%), Positives = 86/91 (94%)
Frame = -1

Query: 509 YCVKAFAEALEVIPYTLAENAGLNPIAIVTELRNHHANGQANAGINVRKGQITNMLEENV 330
YCVK+FAEALEVIPYTLAENAGLNPI IVTELRN HA G+ NAGINVRKGQITN+LEENV
Sbjct: 80 YCVKSFAEALEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQITNILEENV 139

Query: 329 VQPLLVSTSAVSLATECVRMILKIDDIVAVR 237
VQPLLVSTSA++LATECVRMILKIDDIV VR
Sbjct: 140 VQPLLVSTSAITLATECVRMILKIDDIVTVR 170


>tr|A9T431|A9T431_PHYPA T-complex protein 1, delta subunit
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_218689 PE=3 SV=1
Length = 529

Score = 161 bits (408), Expect = 2e-38
Identities = 80/92 (86%), Positives = 87/92 (94%)
Frame = -1

Query: 512 SYCVKAFAEALEVIPYTLAENAGLNPIAIVTELRNHHANGQANAGINVRKGQITNMLEEN 333
SYCV+AFA A+EVIP+TLAENAGLNPI IVTELRN HANG+AN GINVRKGQITN+LEEN
Sbjct: 438 SYCVRAFANAMEVIPFTLAENAGLNPITIVTELRNRHANGEANTGINVRKGQITNILEEN 497

Query: 332 VVQPLLVSTSAVSLATECVRMILKIDDIVAVR 237
VVQPLLVSTSA+SLATECVRMILKIDDIV+ R
Sbjct: 498 VVQPLLVSTSALSLATECVRMILKIDDIVSTR 529