BP916535
Clone id YMU001_000088_G04
Library
Length 499
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000088_G04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GTAACTTCTTGTGCTTCTTCTGCTTCTTCACTTAGGTTTCAGCCCCTCGGTCGAGATCTG
AAGGTTGGCTCCGTTCTTCAGTGACTTGACACGTCAGCAGTTTGTGCACACCCTGTATAC
AAACTTCTTACCTCTTTTTTCGAATTCAAGTGAGTTTTGTTGGTAACTCCGTTTTAAGGA
AGGTCGTAGCCCCCACAACCATTCCCTTCTCAAAACCAAGTCAACACAATCCATATTCCT
AATTTGGAAGTCAAGTGATCTTTGTATCTTTGTATCTCAGCTTCCAAATTGGATACCAAA
GTATCCCTTATCTTCTTGTCCTCGTCATGCATCATAGAGACAACATATTGGTGAGCACTT
GGTTGTTGAGAAAGTTTTAGTTTCTTGACAAGAGCATAATTTACGAAGTTATAAGTAGCA
GAGTCATCTATCATGACCCTAACCCTTTTCCCATTTACAAATCCATGCATTTATACCACT
TCATGTGGGCCAAAACTCG
■■Homology search results ■■ -
sp_hit_id Q8CTR3
Definition sp|Q8CTR3|NAGB_STAES Glucosamine-6-phosphate deaminase OS=Staphylococcus epidermidis (strain ATCC 12228)
Align length 105
Score (bit) 35.0
E-value 0.19
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916535|Adiantum capillus-veneris mRNA, clone:
YMU001_000088_G04.
(499 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8CTR3|NAGB_STAES Glucosamine-6-phosphate deaminase OS=Staphy... 35 0.19
sp|P42339|PI3K_ARATH Phosphatidylinositol 3-kinase VPS34 OS=Arab... 34 0.33
sp|Q5HRH8|NAGB_STAEQ Glucosamine-6-phosphate deaminase OS=Staphy... 31 2.8
sp|P42348|PI3K2_SOYBN Phosphatidylinositol 3-kinase, nodule isof... 31 3.6
sp|P42347|PI3K1_SOYBN Phosphatidylinositol 3-kinase, root isofor... 31 3.6

>sp|Q8CTR3|NAGB_STAES Glucosamine-6-phosphate deaminase
OS=Staphylococcus epidermidis (strain ATCC 12228)
GN=nagB PE=3 SV=1
Length = 243

Score = 35.0 bits (79), Expect = 0.19
Identities = 31/105 (29%), Positives = 48/105 (45%), Gaps = 7/105 (6%)
Frame = -3

Query: 440 RVMIDDSATYNFVNYALVKKLKLSQQPSAHQYVVSMMHDEDKK-------IRDTLVSNLE 282
+V + T+N Y LK S Q S H Y+ ++ ++ I D L NLE
Sbjct: 55 KVDVSQVETFNLDEYV---GLKASHQQSYHTYMNKVLFEQYPHFVKNHIHIPDGLSENLE 111

Query: 281 AEIQRYKDHLTSKLGIWIVLTWF*EGNGCGGYDLP*NGVTNKTHL 147
AE +RY + L + I I + E NG G++ P ++TH+
Sbjct: 112 AEAERYNNLLDERGPIDIQILGIGE-NGHIGFNEPGTDFNSETHV 155


>sp|P42339|PI3K_ARATH Phosphatidylinositol 3-kinase VPS34
OS=Arabidopsis thaliana GN=At1g60490 PE=2 SV=2
Length = 814

Score = 34.3 bits (77), Expect = 0.33
Identities = 21/79 (26%), Positives = 35/79 (44%)
Frame = +3

Query: 216 PSQHNPYS*FGSQVIFVSLYLSFQIGYQSIPYLLVLVMHHRDNILVSTWLLRKF*FLDKS 395
P +H P FG + ++ GY I Y+L + H DN+L++ D
Sbjct: 637 PDEHAP---FGITATCLDTFIKSCAGYSVITYILGIGDRHLDNLLLT----------DDG 683

Query: 396 IIYEVISSRVIYHDPNPFP 452
++ V + ++ DP PFP
Sbjct: 684 RLFHVDFAFILGRDPKPFP 702


>sp|Q5HRH8|NAGB_STAEQ Glucosamine-6-phosphate deaminase
OS=Staphylococcus epidermidis (strain ATCC 35984 /
RP62A) GN=nagB PE=3 SV=1
Length = 243

Score = 31.2 bits (69), Expect = 2.8
Identities = 29/97 (29%), Positives = 43/97 (44%), Gaps = 7/97 (7%)
Frame = -3

Query: 416 TYNFVNYALVKKLKLSQQPSAHQYVVSMMHDEDKK-------IRDTLVSNLEAEIQRYKD 258
T+N Y LK S Q S H Y+ ++ ++ I D NLEAE +RY
Sbjct: 63 TFNLDEYV---GLKASHQQSYHTYMNKVLFEQYPHFAKNHIHIPDGYSENLEAEAERYNK 119

Query: 257 HLTSKLGIWIVLTWF*EGNGCGGYDLP*NGVTNKTHL 147
L + I I + E NG G++ P ++TH+
Sbjct: 120 LLDERGPIDIQILGIGE-NGHIGFNEPGTDFNSETHV 155


>sp|P42348|PI3K2_SOYBN Phosphatidylinositol 3-kinase, nodule isoform
OS=Glycine max PE=2 SV=1
Length = 812

Score = 30.8 bits (68), Expect = 3.6
Identities = 20/79 (25%), Positives = 32/79 (40%)
Frame = +3

Query: 216 PSQHNPYS*FGSQVIFVSLYLSFQIGYQSIPYLLVLVMHHRDNILVSTWLLRKF*FLDKS 395
P H P FG + ++ GY I Y+L + H DN+L+ +
Sbjct: 635 PDDHGP---FGITATCLETFIKSCAGYSVITYILGIGDRHLDNLLLR----------NDG 681

Query: 396 IIYEVISSRVIYHDPNPFP 452
++ V ++ DP PFP
Sbjct: 682 GLFHVDFGFILGRDPKPFP 700


>sp|P42347|PI3K1_SOYBN Phosphatidylinositol 3-kinase, root isoform
OS=Glycine max PE=2 SV=1
Length = 814

Score = 30.8 bits (68), Expect = 3.6
Identities = 20/79 (25%), Positives = 32/79 (40%)
Frame = +3

Query: 216 PSQHNPYS*FGSQVIFVSLYLSFQIGYQSIPYLLVLVMHHRDNILVSTWLLRKF*FLDKS 395
P H P FG + ++ GY I Y+L + H DN+L+ +
Sbjct: 637 PDDHGP---FGITATCLETFIKSCAGYSVITYILGIGDRHLDNLLLR----------NDG 683

Query: 396 IIYEVISSRVIYHDPNPFP 452
++ V ++ DP PFP
Sbjct: 684 GLFHVDFGFILGRDPKPFP 702


tr_hit_id Q75J00
Definition tr|Q75J00|Q75J00_ORYSJ Retrotransposon protein, putative, Ty3-gypsy sub-class OS=Oryza sativa subsp. japonica
Align length 48
Score (bit) 39.3
E-value 0.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916535|Adiantum capillus-veneris mRNA, clone:
YMU001_000088_G04.
(499 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q75J00|Q75J00_ORYSJ Retrotransposon protein, putative, Ty3-gy... 39 0.10
tr|Q10JP7|Q10JP7_ORYSJ Retrotransposon protein, putative, Ty3-gy... 39 0.10
tr|Q5W6K0|Q5W6K0_ORYSJ Retrotransposon protein, putative, Ty3-gy... 39 0.14
tr|Q94BM2|Q94BM2_HORVU Gag-pol polyprotein OS=Hordeum vulgare PE... 39 0.18
tr|Q94BM1|Q94BM1_HORVU Gag-pol polyprotein OS=Hordeum vulgare PE... 39 0.18
tr|B5G4Y0|B5G4Y0_TRIMO Putative gag-pol polyprotein OS=Triticum ... 39 0.18
tr|Q5JPW6|Q5JPW6_ORYSA OSJNBa0085C10.25 protein OS=Oryza sativa ... 37 0.40
tr|Q8H861|Q8H861_ORYSJ Putative polyprotein OS=Oryza sativa subs... 35 1.5
tr|Q109Z1|Q109Z1_ORYSJ Retrotransposon protein, putative, Ty3-gy... 35 1.5
tr|A5B7K4|A5B7K4_VITVI Putative uncharacterized protein OS=Vitis... 35 1.5
tr|Q2RBB2|Q2RBB2_ORYSJ Retrotransposon protein, putative, Ty3-gy... 35 2.0
tr|Q8E1N9|Q8E1N9_STRA5 Primosomal protein N' OS=Streptococcus ag... 35 2.6
tr|Q8CX29|Q8CX29_STRA3 Primosomal replication factor Y (Primosom... 35 2.6
tr|Q65S98|Q65S98_MANSM ArgE protein OS=Mannheimia succiniciprodu... 35 2.6
tr|Q3K366|Q3K366_STRA1 Primosomal protein N' OS=Streptococcus ag... 35 2.6
tr|Q3DUV0|Q3DUV0_STRAG Primosomal replication factor Y (Primosom... 35 2.6
tr|Q3DMT4|Q3DMT4_STRAG Primosomal protein N' OS=Streptococcus ag... 35 2.6
tr|Q3DH82|Q3DH82_STRAG Primosomal protein N' OS=Streptococcus ag... 35 2.6
tr|Q3DAA2|Q3DAA2_STRAG Primosomal protein N' OS=Streptococcus ag... 35 2.6
tr|Q3D4K1|Q3D4K1_STRAG Primosomal protein N' OS=Streptococcus ag... 35 2.6
tr|Q53M39|Q53M39_ORYSJ Retrotransposon protein, putative, Ty3-gy... 35 2.6
tr|Q53JK4|Q53JK4_ORYSJ Retrotransposon protein, putative, Ty3-gy... 35 2.6
tr|Q8RXR0|Q8RXR0_ARATH Putative phosphatidylinositol 3-kinase (F... 34 3.4
tr|Q8H1S8|Q8H1S8_BRANA Phosphatidylinositol 3-kinase OS=Brassica... 34 3.4
tr|Q2R3E8|Q2R3E8_ORYSJ Retrotransposon protein, putative, Ty3-gy... 34 3.4
tr|Q2QSB0|Q2QSB0_ORYSJ Retrotransposon protein, putative, Ty3-gy... 34 3.4
tr|A5CAU1|A5CAU1_VITVI Putative uncharacterized protein OS=Vitis... 34 3.4
tr|A5C0S7|A5C0S7_VITVI Putative uncharacterized protein OS=Vitis... 34 3.4
tr|A5C0K2|A5C0K2_VITVI Putative uncharacterized protein OS=Vitis... 34 3.4
tr|Q53LV2|Q53LV2_ORYSJ Retrotransposon protein, putative, unclas... 32 3.4

>tr|Q75J00|Q75J00_ORYSJ Retrotransposon protein, putative, Ty3-gypsy
sub-class OS=Oryza sativa subsp. japonica GN=Os03g29940
PE=4 SV=1
Length = 1223

Score = 39.3 bits (90), Expect = 0.10
Identities = 17/48 (35%), Positives = 29/48 (60%)
Frame = -3

Query: 458 VNGKRVRVMIDDSATYNFVNYALVKKLKLSQQPSAHQYVVSMMHDEDK 315
+N +R RV+ID + N V++ LVKKL L+ + H Y + ++D +
Sbjct: 487 INNRRARVIIDGGSCNNLVSFDLVKKLGLTTRTHPHPYHIQWLNDSGR 534


>tr|Q10JP7|Q10JP7_ORYSJ Retrotransposon protein, putative, Ty3-gypsy
subclass OS=Oryza sativa subsp. japonica
GN=LOC_Os03g29940 PE=4 SV=1
Length = 1211

Score = 39.3 bits (90), Expect = 0.10
Identities = 17/48 (35%), Positives = 29/48 (60%)
Frame = -3

Query: 458 VNGKRVRVMIDDSATYNFVNYALVKKLKLSQQPSAHQYVVSMMHDEDK 315
+N +R RV+ID + N V++ LVKKL L+ + H Y + ++D +
Sbjct: 492 INNRRARVIIDGGSCNNLVSFDLVKKLGLTTRTHPHPYHIQWLNDSGR 539


>tr|Q5W6K0|Q5W6K0_ORYSJ Retrotransposon protein, putative, Ty3-gypsy
sub-class OS=Oryza sativa subsp. japonica
GN=OSJNBb0085A04.15 PE=4 SV=1
Length = 651

Score = 38.9 bits (89), Expect = 0.14
Identities = 22/67 (32%), Positives = 35/67 (52%)
Frame = -3

Query: 458 VNGKRVRVMIDDSATYNFVNYALVKKLKLSQQPSAHQYVVSMMHDEDKKIRDTLVSNLEA 279
+N +R RV+ID + N V+ LVKKL L+ + H Y + ++D + + T V +
Sbjct: 436 INNRRARVIIDGGSCNNLVSSDLVKKLGLTTRTHPHPYHIQWLNDSG-RAKVTQVCRVSF 494

Query: 278 EIQRYKD 258
I Y D
Sbjct: 495 SIGSYAD 501


>tr|Q94BM2|Q94BM2_HORVU Gag-pol polyprotein OS=Hordeum vulgare PE=4
SV=1
Length = 1720

Score = 38.5 bits (88), Expect = 0.18
Identities = 21/76 (27%), Positives = 36/76 (47%)
Frame = -3

Query: 485 HEVV*MHGFVNGKRVRVMIDDSATYNFVNYALVKKLKLSQQPSAHQYVVSMMHDEDKKIR 306
H + G V + VRV+ID + N + +V+KL L+ +P H Y + ++ K++
Sbjct: 521 HNLFHTKGVVKERSVRVIIDGGSCNNLASMEMVEKLSLTTRPHPHPYYIQWFNNSG-KVK 579

Query: 305 DTLVSNLEAEIQRYKD 258
T + I Y D
Sbjct: 580 VTRTVRVHFSIATYSD 595


>tr|Q94BM1|Q94BM1_HORVU Gag-pol polyprotein OS=Hordeum vulgare PE=4
SV=1
Length = 1717

Score = 38.5 bits (88), Expect = 0.18
Identities = 21/76 (27%), Positives = 36/76 (47%)
Frame = -3

Query: 485 HEVV*MHGFVNGKRVRVMIDDSATYNFVNYALVKKLKLSQQPSAHQYVVSMMHDEDKKIR 306
H + G V + VRV+ID + N + +V+KL L+ +P H Y + ++ K++
Sbjct: 518 HNLFHTKGVVKERSVRVIIDGGSCNNLASMEMVEKLSLTTRPHPHPYYIQWFNNSG-KVK 576

Query: 305 DTLVSNLEAEIQRYKD 258
T + I Y D
Sbjct: 577 VTRTVRVHFSIATYSD 592


>tr|B5G4Y0|B5G4Y0_TRIMO Putative gag-pol polyprotein OS=Triticum
monococcum subsp. aegilopoides GN=gag-pol PE=4 SV=1
Length = 1704

Score = 38.5 bits (88), Expect = 0.18
Identities = 21/78 (26%), Positives = 37/78 (47%)
Frame = -3

Query: 485 HEVV*MHGFVNGKRVRVMIDDSATYNFVNYALVKKLKLSQQPSAHQYVVSMMHDEDKKIR 306
H + G V + VRV+ID + N + +V+KL L +P H Y + ++ K++
Sbjct: 505 HNLFHTKGVVKERSVRVIIDGGSCNNLASMEMVEKLSLITRPHPHPYYIQWFNNSG-KVK 563

Query: 305 DTLVSNLEAEIQRYKDHL 252
T + I Y D++
Sbjct: 564 VTRTVRVHFSISTYADYV 581


>tr|Q5JPW6|Q5JPW6_ORYSA OSJNBa0085C10.25 protein OS=Oryza sativa
GN=OSJNBa0085C10.25 PE=4 SV=1
Length = 625

Score = 37.4 bits (85), Expect = 0.40
Identities = 17/48 (35%), Positives = 28/48 (58%)
Frame = -3

Query: 458 VNGKRVRVMIDDSATYNFVNYALVKKLKLSQQPSAHQYVVSMMHDEDK 315
+N +R RV+ID + N V+ LVKKL L+ + H Y + ++D +
Sbjct: 179 INNRRARVIIDGGSCNNLVSSDLVKKLGLTTRTHPHPYHIQWLNDSGR 226


>tr|Q8H861|Q8H861_ORYSJ Putative polyprotein OS=Oryza sativa subsp.
japonica GN=OSJNBb0005F01.19 PE=4 SV=1
Length = 928

Score = 35.4 bits (80), Expect = 1.5
Identities = 21/67 (31%), Positives = 34/67 (50%)
Frame = -3

Query: 458 VNGKRVRVMIDDSATYNFVNYALVKKLKLSQQPSAHQYVVSMMHDEDKKIRDTLVSNLEA 279
+N R RV+ID + N ++ LVKKL L+ + H Y + ++D + + T V +
Sbjct: 498 INNHRARVIIDGGSCKNLLSSDLVKKLGLTTRTHPHPYHIQWLNDSG-RAKVTQVCRVLF 556

Query: 278 EIQRYKD 258
I Y D
Sbjct: 557 SIGSYAD 563


>tr|Q109Z1|Q109Z1_ORYSJ Retrotransposon protein, putative, Ty3-gypsy
subclass OS=Oryza sativa subsp. japonica
GN=LOC_Os10g11794 PE=4 SV=1
Length = 1315

Score = 35.4 bits (80), Expect = 1.5
Identities = 21/67 (31%), Positives = 34/67 (50%)
Frame = -3

Query: 458 VNGKRVRVMIDDSATYNFVNYALVKKLKLSQQPSAHQYVVSMMHDEDKKIRDTLVSNLEA 279
+N R RV+ID + N ++ LVKKL L+ + H Y + ++D + + T V +
Sbjct: 498 INNHRARVIIDGGSCKNLLSSDLVKKLGLTTRTHPHPYHIQWLNDSG-RAKVTQVCRVLF 556

Query: 278 EIQRYKD 258
I Y D
Sbjct: 557 SIGSYAD 563


>tr|A5B7K4|A5B7K4_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_018548 PE=4 SV=1
Length = 218

Score = 35.4 bits (80), Expect = 1.5
Identities = 18/44 (40%), Positives = 26/44 (59%)
Frame = -3

Query: 470 MHGFVNGKRVRVMIDDSATYNFVNYALVKKLKLSQQPSAHQYVV 339
+H VNG +V+ M+D AT+NFV V KL L + ++Q V
Sbjct: 100 VHAIVNGVQVKPMVDSGATHNFVATRDVAKLGLKLENDSNQIKV 143