BP916537
Clone id YMU001_000088_G06
Library
Length 489
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000088_G06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTGCACACGTGCTCTAGCTTCCCCAAGCTTGTCAGGTACAAAATTGCCTTTTGCGTCCTT
TTCGCTCTTATTTGCTATCTTCTCTGCACCTACCAATGGCGTTGAACCACCATAAGCTAC
ACTGCCCGAAGCGGTTTCCATCAAAGATTGTCCCTCACTGACAGTACCAAATGCTTTCGT
AGGGGCCACAGGAATAGCTAAAACTTGAGGAGTTGGGCTGAGAGAAGGCCCCTGGATTCC
GCTAGCATGAGGTACTTGGGGAACCCCACCATATCTAAGAGTAGTCTCAAACTGCTGTAT
CATGGGCAATATGAGAGCACCTATCGGGCTGTTTATAGCTTCTTCTGGCAGCTTCAGTAT
GAACTCTGGGATGCCCACTCCACATAAAAATTGTGAGACTTCTTCGCTAAAATTGTTGCA
GTTGTGCTGCAGAAGGTTATACGTTTGCACCGTATACCTTGGACTGATCTCCTGCAGATA
CTCATCAAA
■■Homology search results ■■ -
sp_hit_id Q6GLM5
Definition sp|Q6GLM5|F152B_XENLA UPF0326 protein FAM152B OS=Xenopus laevis
Align length 69
Score (bit) 62.4
E-value 1.0e-09
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916537|Adiantum capillus-veneris mRNA, clone:
YMU001_000088_G06.
(489 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6GLM5|F152B_XENLA UPF0326 protein FAM152B OS=Xenopus laevis ... 62 1e-09
sp|Q6ICB0|F152B_HUMAN UPF0326 protein FAM152B OS=Homo sapiens GN... 62 1e-09
sp|Q4KM30|F152B_RAT UPF0326 protein FAM152B OS=Rattus norvegicus... 62 2e-09
sp|Q9CQT7|F152B_MOUSE UPF0326 protein FAM152B OS=Mus musculus GN... 62 2e-09
sp|Q93VG8|U326_ARATH UPF0326 protein At4g17486 OS=Arabidopsis th... 43 7e-04
sp|Q5PQ09|F152A_XENLA UPF0326 protein FAM152A OS=Xenopus laevis ... 43 9e-04
sp|Q5XIT6|F152A_RAT UPF0326 protein FAM152A OS=Rattus norvegicus... 43 9e-04
sp|Q5R456|F152A_PONAB UPF0326 protein FAM152A OS=Pongo abelii GN... 43 9e-04
sp|A3QRX8|F152A_PIG UPF0326 protein FAM152A OS=Sus scrofa GN=FAM... 43 9e-04
sp|Q9D291|F152A_MOUSE UPF0326 protein FAM152A OS=Mus musculus GN... 43 9e-04
sp|Q9BSY9|F152A_HUMAN UPF0326 protein FAM152A OS=Homo sapiens GN... 43 9e-04
sp|Q6DC39|F152A_DANRE UPF0326 protein FAM152A OS=Danio rerio GN=... 41 0.003
sp|Q5ZIV7|F152A_CHICK UPF0326 protein FAM152A OS=Gallus gallus G... 41 0.003
sp|Q8X1T0|HAG1_SCHPO UPF0326 protein hag1 OS=Schizosaccharomyces... 36 0.083
sp|Q91XU1|QKI_RAT Protein quaking OS=Rattus norvegicus GN=Qki PE... 35 0.24
sp|Q5W9D5|QKI_PIG Protein quaking OS=Sus scrofa GN=QKI PE=2 SV=1 35 0.24
sp|Q9QYS9|QKI_MOUSE Protein quaking OS=Mus musculus GN=Qki PE=1 ... 35 0.24
sp|Q96PU8|QKI_HUMAN Protein quaking OS=Homo sapiens GN=QKI PE=1 ... 35 0.24
sp|Q5W9D6|QKI_HORSE Protein quaking OS=Equus caballus GN=QKI PE=... 35 0.24
sp|Q7JJZ8|QKI_FELCA Protein quaking OS=Felis silvestris catus GN... 35 0.24
sp|Q9YH18|QKI_CHICK Protein quaking OS=Gallus gallus GN=QKI PE=2... 35 0.24
sp|Q9GMY1|QKI_CANFA Protein quaking OS=Canis familiaris GN=QKI P... 35 0.24
sp|Q5W9D7|QKI_BOVIN Protein quaking OS=Bos taurus GN=QKI PE=2 SV=1 35 0.24
sp|O43365|HXA3_HUMAN Homeobox protein Hox-A3 OS=Homo sapiens GN=... 35 0.24
sp|Q32L63|VTA1_BOVIN Vacuolar protein sorting-associated protein... 34 0.41
sp|Q08DG7|HXA3_BOVIN Homeobox protein Hox-A3 OS=Bos taurus GN=HO... 34 0.41
sp|Q5R5W5|VTA1_PONAB Vacuolar protein sorting-associated protein... 33 0.54
sp|Q9NP79|VTA1_HUMAN Vacuolar protein sorting-associated protein... 33 0.54
sp|Q86DA5|SARM1_CAEEL Sterile alpha and TIR motif-containing pro... 33 0.54
sp|P02831|HXA3_MOUSE Homeobox protein Hox-A3 OS=Mus musculus GN=... 33 0.54

>sp|Q6GLM5|F152B_XENLA UPF0326 protein FAM152B OS=Xenopus laevis
GN=fam152b PE=2 SV=1
Length = 169

Score = 62.4 bits (150), Expect = 1e-09
Identities = 27/69 (39%), Positives = 44/69 (63%), Gaps = 1/69 (1%)
Frame = -1

Query: 489 FDEYLQEISPR-YTVQTYNLLQHNCNNFSEEVSQFLCGVGIPEFILKLPEEAINSPIGAL 313
F EYL + ++ ++Y+L HNCN FS EV+QFL G IP +I +LP E +++P+G
Sbjct: 85 FLEYLSSLGESGFSGESYHLFDHNCNTFSNEVAQFLTGKKIPSYITELPSEVLSTPLGQA 144

Query: 312 ILPMIQQFE 286
+ P++ +
Sbjct: 145 LRPLLDSVQ 153


>sp|Q6ICB0|F152B_HUMAN UPF0326 protein FAM152B OS=Homo sapiens
GN=FAM152B PE=1 SV=1
Length = 168

Score = 62.4 bits (150), Expect = 1e-09
Identities = 28/69 (40%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
Frame = -1

Query: 489 FDEYLQEISPR-YTVQTYNLLQHNCNNFSEEVSQFLCGVGIPEFILKLPEEAINSPIGAL 313
F EYL + + + YNL +HNCN FS EV+QFL G IP +I LP E +++P G
Sbjct: 84 FLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLTGRKIPSYITDLPSEVLSTPFGQA 143

Query: 312 ILPMIQQFE 286
+ P++ +
Sbjct: 144 LRPLLDSIQ 152


>sp|Q4KM30|F152B_RAT UPF0326 protein FAM152B OS=Rattus norvegicus
GN=Fam152b PE=2 SV=1
Length = 168

Score = 61.6 bits (148), Expect = 2e-09
Identities = 28/69 (40%), Positives = 40/69 (57%), Gaps = 1/69 (1%)
Frame = -1

Query: 489 FDEYLQEISPR-YTVQTYNLLQHNCNNFSEEVSQFLCGVGIPEFILKLPEEAINSPIGAL 313
F EYL + + + YNL +HNCN FS EV+QFL G IP +I LP E +++P G
Sbjct: 84 FLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLTGRKIPSYITDLPSEVLSTPFGQA 143

Query: 312 ILPMIQQFE 286
+ P + +
Sbjct: 144 LRPFLDSIQ 152


>sp|Q9CQT7|F152B_MOUSE UPF0326 protein FAM152B OS=Mus musculus
GN=Fam152b PE=2 SV=1
Length = 168

Score = 61.6 bits (148), Expect = 2e-09
Identities = 28/69 (40%), Positives = 40/69 (57%), Gaps = 1/69 (1%)
Frame = -1

Query: 489 FDEYLQEISPR-YTVQTYNLLQHNCNNFSEEVSQFLCGVGIPEFILKLPEEAINSPIGAL 313
F EYL + + + YNL +HNCN FS EV+QFL G IP +I LP E +++P G
Sbjct: 84 FLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLTGRKIPSYITDLPSEVLSTPFGQA 143

Query: 312 ILPMIQQFE 286
+ P + +
Sbjct: 144 LRPFLDSIQ 152


>sp|Q93VG8|U326_ARATH UPF0326 protein At4g17486 OS=Arabidopsis
thaliana GN=At4g17486 PE=2 SV=1
Length = 224

Score = 43.1 bits (100), Expect = 7e-04
Identities = 20/47 (42%), Positives = 31/47 (65%)
Frame = -1

Query: 489 FDEYLQEISPRYTVQTYNLLQHNCNNFSEEVSQFLCGVGIPEFILKL 349
F Y++++S +Y TY+L+ NCN+F+EEV L G IP +I +L
Sbjct: 102 FRSYMEKLSRKYHGDTYHLIAKNCNHFTEEVCLQLTGKPIPGWINRL 148


>sp|Q5PQ09|F152A_XENLA UPF0326 protein FAM152A OS=Xenopus laevis
GN=fam152a PE=2 SV=1
Length = 192

Score = 42.7 bits (99), Expect = 9e-04
Identities = 16/46 (34%), Positives = 29/46 (63%)
Frame = -1

Query: 486 DEYLQEISPRYTVQTYNLLQHNCNNFSEEVSQFLCGVGIPEFILKL 349
++ ++E+ Y Y+L+ NCN+FS +S+ LCG IP ++ +L
Sbjct: 85 EKIIEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWVNRL 130


>sp|Q5XIT6|F152A_RAT UPF0326 protein FAM152A OS=Rattus norvegicus
GN=Fam152a PE=2 SV=1
Length = 194

Score = 42.7 bits (99), Expect = 9e-04
Identities = 17/46 (36%), Positives = 29/46 (63%)
Frame = -1

Query: 486 DEYLQEISPRYTVQTYNLLQHNCNNFSEEVSQFLCGVGIPEFILKL 349
++ ++E+ Y Y+L+ NCN+FS +S+ LCG IP +I +L
Sbjct: 86 EKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRL 131


>sp|Q5R456|F152A_PONAB UPF0326 protein FAM152A OS=Pongo abelii
GN=FAM152A PE=2 SV=1
Length = 194

Score = 42.7 bits (99), Expect = 9e-04
Identities = 17/46 (36%), Positives = 29/46 (63%)
Frame = -1

Query: 486 DEYLQEISPRYTVQTYNLLQHNCNNFSEEVSQFLCGVGIPEFILKL 349
++ ++E+ Y Y+L+ NCN+FS +S+ LCG IP +I +L
Sbjct: 86 EKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRL 131


>sp|A3QRX8|F152A_PIG UPF0326 protein FAM152A OS=Sus scrofa
GN=FAM152A PE=2 SV=1
Length = 194

Score = 42.7 bits (99), Expect = 9e-04
Identities = 17/46 (36%), Positives = 29/46 (63%)
Frame = -1

Query: 486 DEYLQEISPRYTVQTYNLLQHNCNNFSEEVSQFLCGVGIPEFILKL 349
++ ++E+ Y Y+L+ NCN+FS +S+ LCG IP +I +L
Sbjct: 86 EKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRL 131


>sp|Q9D291|F152A_MOUSE UPF0326 protein FAM152A OS=Mus musculus
GN=Fam152a PE=2 SV=1
Length = 194

Score = 42.7 bits (99), Expect = 9e-04
Identities = 17/46 (36%), Positives = 29/46 (63%)
Frame = -1

Query: 486 DEYLQEISPRYTVQTYNLLQHNCNNFSEEVSQFLCGVGIPEFILKL 349
++ ++E+ Y Y+L+ NCN+FS +S+ LCG IP +I +L
Sbjct: 86 EKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRL 131


tr_hit_id A7QAB6
Definition tr|A7QAB6|A7QAB6_VITVI Chromosome undetermined scaffold_70, whole genome shotgun sequence OS=Vitis vinifera
Align length 163
Score (bit) 135.0
E-value 1.0e-30
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916537|Adiantum capillus-veneris mRNA, clone:
YMU001_000088_G06.
(489 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7QAB6|A7QAB6_VITVI Chromosome undetermined scaffold_70, whol... 135 1e-30
tr|B8LRQ5|B8LRQ5_PICSI Putative uncharacterized protein OS=Picea... 135 1e-30
tr|Q9SFT9|Q9SFT9_ARATH T1B9.26 protein (Putative uncharacterized... 124 2e-27
tr|A9SH91|A9SH91_PHYPA Predicted protein (Fragment) OS=Physcomit... 122 1e-26
tr|B7FIV5|B7FIV5_MEDTR Putative uncharacterized protein OS=Medic... 119 8e-26
tr|B8BHF5|B8BHF5_ORYSI Putative uncharacterized protein OS=Oryza... 116 5e-25
tr|Q9FW61|Q9FW61_ORYSA Putative uncharacterized protein OSJNBb00... 115 1e-24
tr|Q337L1|Q337L1_ORYSJ cDNA clone:J033106J23, full insert sequen... 115 1e-24
tr|Q109J8|Q109J8_ORYSJ Expressed protein OS=Oryza sativa subsp. ... 115 1e-24
tr|Q0IX21|Q0IX21_ORYSJ Os10g0472400 protein (Fragment) OS=Oryza ... 115 1e-24
tr|Q6K3E0|Q6K3E0_ORYSJ Os02g0814000 protein OS=Oryza sativa subs... 112 9e-24
tr|A2XAY0|A2XAY0_ORYSI Putative uncharacterized protein OS=Oryza... 112 9e-24
tr|A3C5N4|A3C5N4_ORYSJ Putative uncharacterized protein OS=Oryza... 109 8e-23
tr|B6TIJ3|B6TIJ3_MAIZE Thioredoxin OS=Zea mays PE=2 SV=1 107 2e-22
tr|Q019Z5|Q019Z5_OSTTA OSJNBa0053L11.37 gene product (ISS) OS=Os... 84 3e-15
tr|B2B545|B2B545_PODAN Predicted CDS Pa_2_3450 OS=Podospora anse... 83 8e-15
tr|A4RWX0|A4RWX0_OSTLU Predicted protein OS=Ostreococcus lucimar... 82 2e-14
tr|A9S0B9|A9S0B9_PHYPA Predicted protein OS=Physcomitrella paten... 80 4e-14
tr|Q4XXP3|Q4XXP3_PLACH Putative uncharacterized protein OS=Plasm... 79 1e-13
tr|A5JZY7|A5JZY7_PLAVI Putative uncharacterized protein OS=Plasm... 79 1e-13
tr|A0E7R0|A0E7R0_PARTE Chromosome undetermined scaffold_81, whol... 79 1e-13
tr|Q7RFH5|Q7RFH5_PLAYO Putative uncharacterized protein PY04731 ... 78 2e-13
tr|Q5AXR5|Q5AXR5_EMENI Putative uncharacterized protein OS=Emeri... 77 3e-13
tr|Q5CSU6|Q5CSU6_CRYPV Putative uncharacterized protein (Fragmen... 77 6e-13
tr|Q5CNM7|Q5CNM7_CRYHO Putative uncharacterized protein OS=Crypt... 77 6e-13
tr|B8LYH6|B8LYH6_9EURO Thioredoxin, putative OS=Talaromyces stip... 76 7e-13
tr|Q4YU42|Q4YU42_PLABE Putative uncharacterized protein OS=Plasm... 76 1e-12
tr|B6PIL5|B6PIL5_BRAFL Putative uncharacterized protein OS=Branc... 75 1e-12
tr|A0EFV5|A0EFV5_PARTE Chromosome undetermined scaffold_94, whol... 74 3e-12
tr|Q0CJI9|Q0CJI9_ASPTN Putative uncharacterized protein OS=Asper... 74 3e-12

>tr|A7QAB6|A7QAB6_VITVI Chromosome undetermined scaffold_70, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00033849001 PE=4 SV=1
Length = 322

Score = 135 bits (340), Expect = 1e-30
Identities = 82/163 (50%), Positives = 99/163 (60%)
Frame = -1

Query: 489 FDEYLQEISPRYTVQTYNLLQHNCNNFSEEVSQFLCGVGIPEFILKLPEEAINSPIGALI 310
F+ YLQEISPRYT +TY+LL+HNCNNFS EV+QFL G IPE+IL+LP E INSP+GALI
Sbjct: 127 FEMYLQEISPRYTAETYSLLKHNCNNFSNEVAQFLVGATIPEYILELPNEVINSPMGALI 186

Query: 309 LPMIQQFETTLRYGGVPQVPHASGIQGPSLSPTPQVLAIPVAPTKAFGTVSEGQSLMETA 130
LPMIQQ ETTLR G VPQVP PS P A + ++E +S +
Sbjct: 187 LPMIQQLETTLRAGAVPQVPQFK----PSAMVQPMPSANGSLNKSSDSCINEAES--NSK 240

Query: 129 SGSVAYGGSTPLVGAEKIANKSEKDAKGNFVPDKLGEARARVQ 1
S + A K A EK A V D LG+AR++VQ
Sbjct: 241 SEKQPSKADVLVPPAVKPAVVKEKPA----VSDPLGDARSKVQ 279


>tr|B8LRQ5|B8LRQ5_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 314

Score = 135 bits (339), Expect = 1e-30
Identities = 65/97 (67%), Positives = 76/97 (78%)
Frame = -1

Query: 489 FDEYLQEISPRYTVQTYNLLQHNCNNFSEEVSQFLCGVGIPEFILKLPEEAINSPIGALI 310
F+EYLQEISPRYT +TY+LL HNCNNFS E++QFL IPEFIL+LPEE +N+P+GAL+
Sbjct: 82 FEEYLQEISPRYTAETYSLLHHNCNNFSNELAQFLVDCSIPEFILRLPEEVMNTPMGALL 141

Query: 309 LPMIQQFETTLRYGGVPQVPHASGIQGPSLSPTPQVL 199
LPM QQ ETTLRYGGVPQ PH S S TP V+
Sbjct: 142 LPMTQQLETTLRYGGVPQAPHLG-----SSSVTPVVV 173


>tr|Q9SFT9|Q9SFT9_ARATH T1B9.26 protein (Putative uncharacterized
protein At3g07090) OS=Arabidopsis thaliana GN=At3g07090
PE=2 SV=1
Length = 265

Score = 124 bits (312), Expect = 2e-27
Identities = 72/163 (44%), Positives = 94/163 (57%)
Frame = -1

Query: 489 FDEYLQEISPRYTVQTYNLLQHNCNNFSEEVSQFLCGVGIPEFILKLPEEAINSPIGALI 310
F+ YL+EISPRYT ++YNLL HNCNNFS EV+QFL G GIP++IL+LP + +NSP+G LI
Sbjct: 82 FEMYLEEISPRYTAESYNLLTHNCNNFSNEVAQFLVGKGIPDYILQLPNDVLNSPMGGLI 141

Query: 309 LPMIQQFETTLRYGGVPQVPHASGIQGPSLSPTPQVLAIPVAPTKAFGTVSEGQSLMETA 130
+PM+Q ETTL+ G VPQV P P PQ A +K G +E A
Sbjct: 142 MPMLQGLETTLKAGAVPQV--------PQFRPQPQPFG---AFSKDDGPQIVIAPKLEAA 190

Query: 129 SGSVAYGGSTPLVGAEKIANKSEKDAKGNFVPDKLGEARARVQ 1
S A P++ +K D LG+ARA++Q
Sbjct: 191 ETSTATEKVPPVI--------QPSASKEKVKDDPLGDARAKIQ 225


>tr|A9SH91|A9SH91_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_129993 PE=4 SV=1
Length = 258

Score = 122 bits (305), Expect = 1e-26
Identities = 54/84 (64%), Positives = 69/84 (82%)
Frame = -1

Query: 489 FDEYLQEISPRYTVQTYNLLQHNCNNFSEEVSQFLCGVGIPEFILKLPEEAINSPIGALI 310
F+EYL++I PRYT QTY+L++HNCNNFS+EV QFL G GIPE+IL+LPEE ++SP+G L+
Sbjct: 80 FEEYLRDIQPRYTQQTYSLMKHNCNNFSDEVCQFLVGSGIPEYILRLPEEVLSSPMGGLL 139

Query: 309 LPMIQQFETTLRYGGVPQVPHASG 238
PMI+ ETTLR GGVP P+ G
Sbjct: 140 RPMIENLETTLRNGGVPGAPYQVG 163


>tr|B7FIV5|B7FIV5_MEDTR Putative uncharacterized protein OS=Medicago
truncatula PE=2 SV=1
Length = 231

Score = 119 bits (298), Expect = 8e-26
Identities = 67/149 (44%), Positives = 89/149 (59%), Gaps = 2/149 (1%)
Frame = -1

Query: 489 FDEYLQEISPRYTVQTYNLLQHNCNNFSEEVSQFLCGVGIPEFILKLPEEAINSPIGALI 310
F+ YLQEI+PRY +TY+LL HNCNNFS EV+QFL G IP++IL+LP E ++SP+G+L
Sbjct: 82 FEMYLQEINPRYLPETYSLLTHNCNNFSNEVAQFLVGATIPDYILQLPNEVMSSPMGSLF 141

Query: 309 LPMIQQFETTLRYGGVPQVPHASGIQGPSLSPTPQVLAIPVAPTKAFGTVSEGQSLMETA 130
LPMIQ ETTL+ GGVPQV PQ V+P F +V+ T
Sbjct: 142 LPMIQNLETTLKSGGVPQV--------------PQFRPTTVSPASNFASVT-------TQ 180

Query: 129 SGSVAYGGST--PLVGAEKIANKSEKDAK 49
S A ST + ++++A E+D K
Sbjct: 181 KSSTAPNSSTEKKAIPSKEVAKGKEEDKK 209


>tr|B8BHF5|B8BHF5_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_34002 PE=4 SV=1
Length = 291

Score = 116 bits (291), Expect = 5e-25
Identities = 73/171 (42%), Positives = 97/171 (56%), Gaps = 8/171 (4%)
Frame = -1

Query: 489 FDEYLQEISPRYTVQTYNLLQHNCNNFSEEVSQFLCGVGIPEFILKLPEEAINSPIGALI 310
F+++LQ+ISPRYT TYNLL +NCNNF+ E +QFL G IP +IL+LP E +NSP GALI
Sbjct: 82 FEDFLQDISPRYTPATYNLLSNNCNNFTNEAAQFLVGSAIPSYILELPNEVMNSPFGALI 141

Query: 309 LPMIQQFETTLRYGGVPQVPH--ASGIQGPSLSPTPQVLAIPVAPTKAFGTVSEGQSLME 136
LPMIQ ET+LR G PQ P S + + + +P +I V P T S+ +
Sbjct: 142 LPMIQGLETSLRAGVAPQPPQFKPSPVAAVTATQSPPSGSIHVEPK---STASDKTEVDN 198

Query: 135 TASGSVAYGGSTPLVGAEKIANKSEKD--AKGNFVP----DKLGEARARVQ 1
GG P V +A ++ A+ N P D L EA++RVQ
Sbjct: 199 NG------GGIPPAVQPAPVAAETSPAAVAEANMAPPPPVDPLREAKSRVQ 243


>tr|Q9FW61|Q9FW61_ORYSA Putative uncharacterized protein
OSJNBb0094K03.5 OS=Oryza sativa GN=OSJNBb0094K03.5 PE=4
SV=1
Length = 366

Score = 115 bits (288), Expect = 1e-24
Identities = 69/165 (41%), Positives = 92/165 (55%), Gaps = 2/165 (1%)
Frame = -1

Query: 489 FDEYLQEISPRYTVQTYNLLQHNCNNFSEEVSQFLCGVGIPEFILKLPEEAINSPIGALI 310
F+++LQ+I+PRYT YNLL +NCNNF+ E +QFL G IP +IL+LP E +NSPIGALI
Sbjct: 157 FEDFLQDINPRYTPANYNLLSNNCNNFTNEAAQFLVGSAIPSYILELPNEVMNSPIGALI 216

Query: 309 LPMIQQFETTLRYGGVPQVPH--ASGIQGPSLSPTPQVLAIPVAPTKAFGTVSEGQSLME 136
LPMIQ ET+LR G PQ P S + + + +P +I V P T S+ +
Sbjct: 217 LPMIQGLETSLRAGVAPQPPQFKPSPVAAVTATQSPPSGSIHVEPK---STASDKTEVDN 273

Query: 135 TASGSVAYGGSTPLVGAEKIANKSEKDAKGNFVPDKLGEARARVQ 1
G P+ A A +E D L EA++RVQ
Sbjct: 274 NGGGIPPAVQPAPVAAATSPAAVAEASMAPPPPVDPLREAKSRVQ 318


>tr|Q337L1|Q337L1_ORYSJ cDNA clone:J033106J23, full insert sequence
OS=Oryza sativa subsp. japonica GN=LOC_Os10g33350 PE=2
SV=1
Length = 291

Score = 115 bits (288), Expect = 1e-24
Identities = 69/165 (41%), Positives = 92/165 (55%), Gaps = 2/165 (1%)
Frame = -1

Query: 489 FDEYLQEISPRYTVQTYNLLQHNCNNFSEEVSQFLCGVGIPEFILKLPEEAINSPIGALI 310
F+++LQ+I+PRYT YNLL +NCNNF+ E +QFL G IP +IL+LP E +NSPIGALI
Sbjct: 82 FEDFLQDINPRYTPANYNLLSNNCNNFTNEAAQFLVGSAIPSYILELPNEVMNSPIGALI 141

Query: 309 LPMIQQFETTLRYGGVPQVPH--ASGIQGPSLSPTPQVLAIPVAPTKAFGTVSEGQSLME 136
LPMIQ ET+LR G PQ P S + + + +P +I V P T S+ +
Sbjct: 142 LPMIQGLETSLRAGVAPQPPQFKPSPVAAVTATQSPPSGSIHVEPK---STASDKTEVDN 198

Query: 135 TASGSVAYGGSTPLVGAEKIANKSEKDAKGNFVPDKLGEARARVQ 1
G P+ A A +E D L EA++RVQ
Sbjct: 199 NGGGIPPAVQPAPVAAATSPAAVAEASMAPPPPVDPLREAKSRVQ 243


>tr|Q109J8|Q109J8_ORYSJ Expressed protein OS=Oryza sativa subsp.
japonica GN=LOC_Os10g33350 PE=4 SV=1
Length = 273

Score = 115 bits (288), Expect = 1e-24
Identities = 69/165 (41%), Positives = 92/165 (55%), Gaps = 2/165 (1%)
Frame = -1

Query: 489 FDEYLQEISPRYTVQTYNLLQHNCNNFSEEVSQFLCGVGIPEFILKLPEEAINSPIGALI 310
F+++LQ+I+PRYT YNLL +NCNNF+ E +QFL G IP +IL+LP E +NSPIGALI
Sbjct: 64 FEDFLQDINPRYTPANYNLLSNNCNNFTNEAAQFLVGSAIPSYILELPNEVMNSPIGALI 123

Query: 309 LPMIQQFETTLRYGGVPQVPH--ASGIQGPSLSPTPQVLAIPVAPTKAFGTVSEGQSLME 136
LPMIQ ET+LR G PQ P S + + + +P +I V P T S+ +
Sbjct: 124 LPMIQGLETSLRAGVAPQPPQFKPSPVAAVTATQSPPSGSIHVEPK---STASDKTEVDN 180

Query: 135 TASGSVAYGGSTPLVGAEKIANKSEKDAKGNFVPDKLGEARARVQ 1
G P+ A A +E D L EA++RVQ
Sbjct: 181 NGGGIPPAVQPAPVAAATSPAAVAEASMAPPPPVDPLREAKSRVQ 225


>tr|Q0IX21|Q0IX21_ORYSJ Os10g0472400 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os10g0472400 PE=4 SV=1
Length = 319

Score = 115 bits (288), Expect = 1e-24
Identities = 69/165 (41%), Positives = 92/165 (55%), Gaps = 2/165 (1%)
Frame = -1

Query: 489 FDEYLQEISPRYTVQTYNLLQHNCNNFSEEVSQFLCGVGIPEFILKLPEEAINSPIGALI 310
F+++LQ+I+PRYT YNLL +NCNNF+ E +QFL G IP +IL+LP E +NSPIGALI
Sbjct: 110 FEDFLQDINPRYTPANYNLLSNNCNNFTNEAAQFLVGSAIPSYILELPNEVMNSPIGALI 169

Query: 309 LPMIQQFETTLRYGGVPQVPH--ASGIQGPSLSPTPQVLAIPVAPTKAFGTVSEGQSLME 136
LPMIQ ET+LR G PQ P S + + + +P +I V P T S+ +
Sbjct: 170 LPMIQGLETSLRAGVAPQPPQFKPSPVAAVTATQSPPSGSIHVEPK---STASDKTEVDN 226

Query: 135 TASGSVAYGGSTPLVGAEKIANKSEKDAKGNFVPDKLGEARARVQ 1
G P+ A A +E D L EA++RVQ
Sbjct: 227 NGGGIPPAVQPAPVAAATSPAAVAEASMAPPPPVDPLREAKSRVQ 271