BP916540
Clone id YMU001_000088_G10
Library
Length 515
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000088_G10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTTGTTGCAATTGCAAAAGCCGTCTCACAAGCATGTCATTCCAAATATCCGTAACGCCAG
GCAAACACCAATGCATGCAATCTTCATGAAGCTTCCCTGCAGATAGCGAGGGGTGTGCAT
CAGCTCGTAGTGAGCTCAAGTACGAAATATTCAGGAGCTCAAACTTGGTGCCTTGGATAG
CCTTCTCCAGGTGCAGGTTGGCTTTACTCATCTCCACATTTGGGCCAGGTTTCCCGCTCA
ATGCAAACCATGTCTTTGCCTCCTCTTCAGTTAGTGGTTTAGAACGATGGCAACTACCAC
CTTCATTCCAATCACCGCCTTCAAAATGCCGGGGCGATTGCATTCGCAAAAACATCAAGC
CCTCTGCTGGCATTCGTTGTTCTACATAAGCAATCATGCTCTTCAACACCATATCCAGGC
CCTCTTCAGGTGGCTTTGTCGGAATAATTGGCTCTCCTTTCTCAAAAAATATCATAGGAG
TCTTCACAGGATCAAACTTCTCCGGTGCCCACCAC
■■Homology search results ■■ -
sp_hit_id B0C3E3
Definition sp|B0C3E3|LSPA_ACAM1 Lipoprotein signal peptidase OS=Acaryochloris marina (strain MBIC 11017)
Align length 32
Score (bit) 32.7
E-value 1.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916540|Adiantum capillus-veneris mRNA, clone:
YMU001_000088_G10.
(515 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|B0C3E3|LSPA_ACAM1 Lipoprotein signal peptidase OS=Acaryochlor... 33 1.0
sp|Q9BZQ2|CA014_HUMAN Uncharacterized protein C1orf14 OS=Homo sa... 33 1.0
sp|Q9VWN5|CARP_DROME Protein CARP homolog OS=Drosophila melanoga... 32 1.3
sp|P46358|RFAY_XANCP Probable RNA polymerase sigma factor rfaY O... 31 3.0
sp|Q08046|EF1A_GIALA Elongation factor 1-alpha (Fragment) OS=Gia... 31 3.9
sp|Q6PAM1|TXLNA_MOUSE Alpha-taxilin OS=Mus musculus GN=Txlna PE=... 30 5.1
sp|Q9C3Z4|NOG2_PNECA Nucleolar GTP-binding protein 2 OS=Pneumocy... 30 5.1
sp|Q502M5|EDC3_DANRE Enhancer of mRNA-decapping protein 3 OS=Dan... 30 5.1
sp|Q1JPX3|SYFA_DANRE Phenylalanyl-tRNA synthetase alpha chain OS... 30 6.7
sp|P43635|CISY3_YEAST Citrate synthase 3 OS=Saccharomyces cerevi... 30 6.7
sp|Q08DD1|ARSA_BOVIN Arylsulfatase A OS=Bos taurus GN=ARSA PE=2 ... 30 8.7

>sp|B0C3E3|LSPA_ACAM1 Lipoprotein signal peptidase OS=Acaryochloris
marina (strain MBIC 11017) GN=lspA PE=3 SV=1
Length = 165

Score = 32.7 bits (73), Expect = 1.0
Identities = 12/32 (37%), Positives = 20/32 (62%)
Frame = +3

Query: 141 YEIFRSSNLVPWIAFSRCRLALLISTFGPGFP 236
+ +F+ S L+PW++F C + + FGP FP
Sbjct: 61 FSLFKDSPLLPWLSFLVCLGLIGLGLFGPRFP 92


>sp|Q9BZQ2|CA014_HUMAN Uncharacterized protein C1orf14 OS=Homo
sapiens GN=C1orf14 PE=1 SV=2
Length = 725

Score = 32.7 bits (73), Expect = 1.0
Identities = 27/101 (26%), Positives = 44/101 (43%), Gaps = 4/101 (3%)
Frame = -2

Query: 313 DWNEGGSCHRSKPLTEEEAKTWFALSGK--PGPNVEMSKANLHLEKAIQGTKFELLNISY 140
DW++ SC L EE W + PGP + K L K + EL I Y
Sbjct: 338 DWDDEESCENYTALIEERINLWCDIQDGTIPGPIAQRFKKTLEKYK---NKRVEL--IEY 392

Query: 139 LSSLRAD--AHPSLSAGKLHEDCMHWCLPGVTDIWNDMLVR 23
S+++ D A ++ K + + + C G+ +W D+ +R
Sbjct: 393 QSNIKEDPSAAEAVECWKKYYEIVMLC--GLLKMWEDLRLR 431


>sp|Q9VWN5|CARP_DROME Protein CARP homolog OS=Drosophila
melanogaster GN=CG7332 PE=1 SV=1
Length = 560

Score = 32.3 bits (72), Expect = 1.3
Identities = 23/78 (29%), Positives = 35/78 (44%)
Frame = -2

Query: 316 GDWNEGGSCHRSKPLTEEEAKTWFALSGKPGPNVEMSKANLHLEKAIQGTKFELLNISYL 137
G+ E GS + P EEE+ AL+G+ + E +E+A + T + +S
Sbjct: 200 GNATEAGSTKKRSPAGEEES----ALAGQAAGSSE------EVEEAAEATPASVSKLSQA 249

Query: 136 SSLRADAHPSLSAGKLHE 83
L D H LS + HE
Sbjct: 250 LQLEHDMHQELSPDEFHE 267


>sp|P46358|RFAY_XANCP Probable RNA polymerase sigma factor rfaY
OS=Xanthomonas campestris pv. campestris GN=rfaY PE=3
SV=2
Length = 400

Score = 31.2 bits (69), Expect = 3.0
Identities = 30/108 (27%), Positives = 46/108 (42%), Gaps = 7/108 (6%)
Frame = -2

Query: 406 LKSMIAYVEQRMPAEGLMFLRMQSPRHFEGGDWNEGGSCHRSKPLTEEEAKTWFALSGKP 227
L++ + PA L +LR Q R+ DW HR +PL+ E A A++ P
Sbjct: 59 LRAWQRLAQLHQPASFLPWLR-QITRNL-ARDWLRS---HRHRPLSGEAADLAIAMAADP 113

Query: 226 GPN-------VEMSKANLHLEKAIQGTKFELLNISYLSSLRADAHPSL 104
P+ VE +A L + A+ E+L + Y R+ SL
Sbjct: 114 SPSPAEQALQVEEERAALEIMSALPNDSREILLLYYREGQRSQQVASL 161


>sp|Q08046|EF1A_GIALA Elongation factor 1-alpha (Fragment)
OS=Giardia lamblia GN=TEF1 PE=2 SV=1
Length = 396

Score = 30.8 bits (68), Expect = 3.9
Identities = 13/36 (36%), Positives = 19/36 (52%)
Frame = +3

Query: 279 LERWQLPPSFQSPPSKCRGDCIRKNIKPSAGIRCST 386
L++ L P ++PP RGDCI + P + C T
Sbjct: 348 LDKRTLKPEMENPPDAGRGDCIIVKMVPQKPLCCET 383


>sp|Q6PAM1|TXLNA_MOUSE Alpha-taxilin OS=Mus musculus GN=Txlna PE=2
SV=1
Length = 554

Score = 30.4 bits (67), Expect = 5.1
Identities = 14/53 (26%), Positives = 26/53 (49%)
Frame = -2

Query: 322 EGGDWNEGGSCHRSKPLTEEEAKTWFALSGKPGPNVEMSKANLHLEKAIQGTK 164
+GG EG ++P E+++T+ A +G+P P + + K GT+
Sbjct: 91 QGGPAEEGAQGEPTEPEDTEKSRTYAARNGEPEPGIPVVNGEKETSKGEPGTE 143


>sp|Q9C3Z4|NOG2_PNECA Nucleolar GTP-binding protein 2
OS=Pneumocystis carinii GN=NOG2 PE=2 SV=1
Length = 483

Score = 30.4 bits (67), Expect = 5.1
Identities = 14/44 (31%), Positives = 22/44 (50%)
Frame = +1

Query: 301 LHSNHRLQNAGAIAFAKTSSPLLAFVVLHKQSCSSTPYPGPLQV 432
LHSN R + G I + T + + K+ C++ P PG +V
Sbjct: 286 LHSNRRQISVGFIGYPNTGKSSVINTLRSKKVCNTAPIPGETKV 329


>sp|Q502M5|EDC3_DANRE Enhancer of mRNA-decapping protein 3 OS=Danio
rerio GN=edc3 PE=1 SV=1
Length = 507

Score = 30.4 bits (67), Expect = 5.1
Identities = 26/97 (26%), Positives = 40/97 (41%), Gaps = 2/97 (2%)
Frame = -2

Query: 409 VLKSMIAYVEQRMPAEGLMFLRMQSPRHFEGGDWNEGGSCHRSKP-LTEEEAKTWFALSG 233
+ K+ I +Q P L R +GG GG+ S P + +A+ G
Sbjct: 67 ISKNSIEVSKQNGPESSSTTLMPHVGRKDKGGGGGGGGAPANSAPVMVPNKAEPRLQEGG 126

Query: 232 -KPGPNVEMSKANLHLEKAIQGTKFELLNISYLSSLR 125
P P+ S H++ A+QG F + S+ SS R
Sbjct: 127 VSPVPHYSKSYGERHIDMAVQGKGFRRRHNSWSSSCR 163


>sp|Q1JPX3|SYFA_DANRE Phenylalanyl-tRNA synthetase alpha chain
OS=Danio rerio GN=farsa PE=2 SV=2
Length = 497

Score = 30.0 bits (66), Expect = 6.7
Identities = 19/66 (28%), Positives = 27/66 (40%)
Frame = +2

Query: 278 FRTMATTTFIPITAFKMPGRLHSQKHQALCWHSLFYISNHALQHHIQALFRWLCRNNWLS 457
F M T FI + + Q+H A H F+IS+ AL H ++L
Sbjct: 243 FTEMPTNNFIESSFWNFDSLFQPQQHPARDQHDTFFISDPALAHEFP--------RDYLE 294

Query: 458 FLKKYH 475
+KK H
Sbjct: 295 RVKKVH 300


>sp|P43635|CISY3_YEAST Citrate synthase 3 OS=Saccharomyces
cerevisiae GN=CIT3 PE=3 SV=1
Length = 486

Score = 30.0 bits (66), Expect = 6.7
Identities = 25/87 (28%), Positives = 33/87 (37%), Gaps = 9/87 (10%)
Frame = -2

Query: 262 EAKTWFALSGKPGPNVEMSKANLHLEKAIQGTKFELLNISYLSSLRADAHP--------- 110
E+ W ++G G A+ E AI+G K LSSL D HP
Sbjct: 114 ESMLWLLMTG--GVPTFQQAASFRKELAIRGRKLPHYTEKVLSSLPKDMHPMTQLAIGLA 171

Query: 109 SLSAGKLHEDCMHWCLPGVTDIWNDML 29
S++ G L L G + W D L
Sbjct: 172 SMNKGSLFATNYQKGLIGKMEFWKDTL 198


tr_hit_id A7QH01
Definition tr|A7QH01|A7QH01_VITVI Chromosome chr3 scaffold_95, whole genome shotgun sequence OS=Vitis vinifera
Align length 166
Score (bit) 214.0
E-value 2.0e-54
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916540|Adiantum capillus-veneris mRNA, clone:
YMU001_000088_G10.
(515 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7QH01|A7QH01_VITVI Chromosome chr3 scaffold_95, whole genome... 214 2e-54
tr|A5B672|A5B672_VITVI Putative uncharacterized protein OS=Vitis... 214 2e-54
tr|Q69RQ8|Q69RQ8_ORYSJ Os07g0498900 protein OS=Oryza sativa subs... 209 6e-53
tr|A2YLK2|A2YLK2_ORYSI Putative uncharacterized protein OS=Oryza... 209 6e-53
tr|B4FKU2|B4FKU2_MAIZE Putative uncharacterized protein OS=Zea m... 201 2e-50
tr|Q9ZQR5|Q9ZQR5_ARATH Putative uncharacterized protein At2g1453... 195 1e-48
tr|A7QSB5|A7QSB5_VITVI Chromosome chr3 scaffold_157, whole genom... 172 1e-41
tr|Q9FGE9|Q9FGE9_ARATH Gb|AAD15463.1 (Putative uncharacterized p... 164 2e-39
tr|Q6ZGL3|Q6ZGL3_ORYSJ Os02g0117900 protein OS=Oryza sativa subs... 155 1e-36
tr|A3A2G9|A3A2G9_ORYSJ Putative uncharacterized protein OS=Oryza... 155 1e-36
tr|A2X053|A2X053_ORYSI Putative uncharacterized protein OS=Oryza... 155 1e-36
tr|B4FXF1|B4FXF1_MAIZE Putative uncharacterized protein OS=Zea m... 155 1e-36
tr|A9TRH6|A9TRH6_PHYPA Predicted protein OS=Physcomitrella paten... 141 2e-32
tr|B8LL59|B8LL59_PICSI Putative uncharacterized protein OS=Picea... 101 2e-20
tr|Q944J6|Q944J6_ARATH AT5g64470/T12B11_6 OS=Arabidopsis thalian... 98 2e-19
tr|Q10MI5|Q10MI5_ORYSJ Expressed protein (Putative uncharacteriz... 98 3e-19
tr|Q9LHL6|Q9LHL6_ARATH Gb|AAF30301.1 (Putative uncharacterized p... 94 4e-18
tr|A0MEV4|A0MEV4_ARATH Putative uncharacterized protein (Fragmen... 94 4e-18
tr|Q67VA0|Q67VA0_ORYSJ Leaf senescence protein-like (Putative un... 94 5e-18
tr|A2YB18|A2YB18_ORYSI Putative uncharacterized protein OS=Oryza... 94 5e-18
tr|A7PAJ8|A7PAJ8_VITVI Chromosome chr14 scaffold_9, whole genome... 92 1e-17
tr|A7PKU1|A7PKU1_VITVI Chromosome chr7 scaffold_20, whole genome... 91 3e-17
tr|A9NUP3|A9NUP3_PICSI Putative uncharacterized protein OS=Picea... 91 3e-17
tr|Q9LZQ1|Q9LZQ1_ARATH Putative uncharacterized protein T12C14_9... 90 6e-17
tr|Q93ZW1|Q93ZW1_ARATH Putative uncharacterized protein At5g2068... 90 7e-17
tr|A8MQ97|A8MQ97_ARATH Uncharacterized protein At5g20680.2 OS=Ar... 90 7e-17
tr|B4FAW0|B4FAW0_MAIZE Putative uncharacterized protein OS=Zea m... 89 1e-16
tr|A9SPN8|A9SPN8_PHYPA Predicted protein OS=Physcomitrella paten... 89 1e-16
tr|A9PIG7|A9PIG7_POPTR Putative uncharacterized protein OS=Popul... 89 1e-16
tr|A5AV05|A5AV05_VITVI Putative uncharacterized protein OS=Vitis... 89 1e-16

>tr|A7QH01|A7QH01_VITVI Chromosome chr3 scaffold_95, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00038563001
PE=4 SV=1
Length = 347

Score = 214 bits (546), Expect = 2e-54
Identities = 95/166 (57%), Positives = 118/166 (71%)
Frame = -2

Query: 514 WWAPEKFDPVKTPMIFFEKGEPIIPTKPPEEGLDMVLKSMIAYVEQRMPAEGLMFLRMQS 335
WWAP KFDPVK+PM+FFE G P+IP PP GLD+VLK MI++VE+RM G+ F R QS
Sbjct: 176 WWAPSKFDPVKSPMLFFENGLPLIPALPPHVGLDLVLKHMISFVERRMRTGGIKFFRTQS 235

Query: 334 PRHFEGGDWNEGGSCHRSKPLTEEEAKTWFALSGKPGPNVEMSKANLHLEKAIQGTKFEL 155
PRHFEGGDW++GG C +PL E+ + F+L G NVE N HL KA+QG+ F +
Sbjct: 236 PRHFEGGDWDQGGFCQHLQPLLPEQVEELFSLENN-GTNVETRLVNQHLYKALQGSDFHI 294

Query: 154 LNISYLSSLRADAHPSLSAGKLHEDCMHWCLPGVTDIWNDMLVRRL 17
L I+ +S RADAHPS + GK H+DCMHWCLPG TD WND+ + L
Sbjct: 295 LEITRMSEFRADAHPSTAGGKKHDDCMHWCLPGTTDTWNDLFITHL 340


>tr|A5B672|A5B672_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_006073 PE=4 SV=1
Length = 422

Score = 214 bits (545), Expect = 2e-54
Identities = 95/166 (57%), Positives = 118/166 (71%)
Frame = -2

Query: 514 WWAPEKFDPVKTPMIFFEKGEPIIPTKPPEEGLDMVLKSMIAYVEQRMPAEGLMFLRMQS 335
WWAP KFDPVK+PM+FFE G P+IP PP GLD+VLK MI++VE+RM G+ F R QS
Sbjct: 251 WWAPSKFDPVKSPMLFFENGLPLIPXLPPHVGLDLVLKHMISFVERRMRTGGIKFFRTQS 310

Query: 334 PRHFEGGDWNEGGSCHRSKPLTEEEAKTWFALSGKPGPNVEMSKANLHLEKAIQGTKFEL 155
PRHFEGGDW++GG C +PL E+ + F+L G NVE N HL KA+QG+ F +
Sbjct: 311 PRHFEGGDWDQGGFCQHLQPLLPEQVEELFSLENN-GTNVETRLVNQHLYKALQGSDFHI 369

Query: 154 LNISYLSSLRADAHPSLSAGKLHEDCMHWCLPGVTDIWNDMLVRRL 17
L I+ +S RADAHPS + GK H+DCMHWCLPG TD WND+ + L
Sbjct: 370 LEITRMSEFRADAHPSTAGGKKHDDCMHWCLPGTTDTWNDLFITHL 415


>tr|Q69RQ8|Q69RQ8_ORYSJ Os07g0498900 protein OS=Oryza sativa subsp.
japonica GN=OSJNBb0055I24.101 PE=2 SV=1
Length = 413

Score = 209 bits (532), Expect = 6e-53
Identities = 95/167 (56%), Positives = 117/167 (70%)
Frame = -2

Query: 514 WWAPEKFDPVKTPMIFFEKGEPIIPTKPPEEGLDMVLKSMIAYVEQRMPAEGLMFLRMQS 335
WWAP KF+PV++PM+FFEKG P+IP P GLD+ LK MI +V + M G+ R QS
Sbjct: 244 WWAPSKFNPVQSPMLFFEKGIPVIPPLLPPAGLDLALKHMIIFVNKAMRPNGVKLFRTQS 303

Query: 334 PRHFEGGDWNEGGSCHRSKPLTEEEAKTWFALSGKPGPNVEMSKANLHLEKAIQGTKFEL 155
PRHFEGGDWNEGGSC R KPL+ EE + F+L G NVE N HL +A++ + F +
Sbjct: 304 PRHFEGGDWNEGGSCQRDKPLSAEEVEELFSLDNN-GTNVEARLVNQHLVRALEKSTFNV 362

Query: 154 LNISYLSSLRADAHPSLSAGKLHEDCMHWCLPGVTDIWNDMLVRRLL 14
LNI+ +S RADAHPS + GK H+DCMHWCLPG TD WND+L LL
Sbjct: 363 LNITGMSEFRADAHPSTTGGKKHDDCMHWCLPGPTDTWNDLLAANLL 409


>tr|A2YLK2|A2YLK2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_26100 PE=4 SV=1
Length = 413

Score = 209 bits (532), Expect = 6e-53
Identities = 95/167 (56%), Positives = 117/167 (70%)
Frame = -2

Query: 514 WWAPEKFDPVKTPMIFFEKGEPIIPTKPPEEGLDMVLKSMIAYVEQRMPAEGLMFLRMQS 335
WWAP KF+PV++PM+FFEKG P+IP P GLD+ LK MI +V + M G+ R QS
Sbjct: 244 WWAPSKFNPVQSPMLFFEKGIPVIPPLLPPAGLDLALKHMIIFVNKAMRPNGVKLFRTQS 303

Query: 334 PRHFEGGDWNEGGSCHRSKPLTEEEAKTWFALSGKPGPNVEMSKANLHLEKAIQGTKFEL 155
PRHFEGGDWNEGGSC R KPL+ EE + F+L G NVE N HL +A++ + F +
Sbjct: 304 PRHFEGGDWNEGGSCQRDKPLSAEEVEELFSLDNN-GTNVEARLVNQHLVRALEKSTFNV 362

Query: 154 LNISYLSSLRADAHPSLSAGKLHEDCMHWCLPGVTDIWNDMLVRRLL 14
LNI+ +S RADAHPS + GK H+DCMHWCLPG TD WND+L LL
Sbjct: 363 LNITGMSEFRADAHPSTTGGKKHDDCMHWCLPGPTDTWNDLLAANLL 409


>tr|B4FKU2|B4FKU2_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 408

Score = 201 bits (510), Expect = 2e-50
Identities = 90/170 (52%), Positives = 117/170 (68%)
Frame = -2

Query: 514 WWAPEKFDPVKTPMIFFEKGEPIIPTKPPEEGLDMVLKSMIAYVEQRMPAEGLMFLRMQS 335
WWAP KFDP+++PM+FFEKG PI+P P GLD+ L++MI++ + + F R QS
Sbjct: 239 WWAPSKFDPIRSPMLFFEKGRPIVPPLLPPAGLDLALQNMISFANKATRPNTVKFFRTQS 298

Query: 334 PRHFEGGDWNEGGSCHRSKPLTEEEAKTWFALSGKPGPNVEMSKANLHLEKAIQGTKFEL 155
PRHFEGGDWNEGGSC ++PL+ +E + F+L NVE N HL KA+Q T F +
Sbjct: 299 PRHFEGGDWNEGGSCQCNQPLSSKEVEEIFSLDNN-STNVEARLVNQHLVKALQQTSFRV 357

Query: 154 LNISYLSSLRADAHPSLSAGKLHEDCMHWCLPGVTDIWNDMLVRRLLQLQ 5
L+I+ +S RADAHPS + GK H+DCMHWCLPG TD WND+L L L+
Sbjct: 358 LDITRMSEFRADAHPSTTGGKKHDDCMHWCLPGPTDTWNDLLALSLEALE 407


>tr|Q9ZQR5|Q9ZQR5_ARATH Putative uncharacterized protein At2g14530
(At2g14530/T13P21.9) OS=Arabidopsis thaliana
GN=At2g14530 PE=2 SV=1
Length = 412

Score = 195 bits (496), Expect = 1e-48
Identities = 87/167 (52%), Positives = 119/167 (71%), Gaps = 1/167 (0%)
Frame = -2

Query: 514 WWAPEKFDPVKTPMIFFEKGEPIIPTKPPEEGLDMVLKSMIAYVEQRMPAEGLMFLRMQS 335
WWAP KFDPVK+PM+FFE G PI+P PP GLD VL +M+ +VE+ G++F R QS
Sbjct: 241 WWAPSKFDPVKSPMLFFEGGRPILPPIPPATGLDRVLNNMVNFVEKTKRPGGIIFFRTQS 300

Query: 334 PRHFEGGDWNEGGSCHRSKPLTEEEAKTWFALSGKPGPNVEMSKANLHLEKAIQG-TKFE 158
PRHFEGGDW++GG+C R +PL + + +F++ G G NVE+ N HL +++ + F
Sbjct: 301 PRHFEGGDWDQGGTCQRLQPLLPGKVEEFFSV-GNNGTNVEVRLVNQHLYNSLKSRSAFH 359

Query: 157 LLNISYLSSLRADAHPSLSAGKLHEDCMHWCLPGVTDIWNDMLVRRL 17
+L+I+ +S RADAHP+ + GK H+DCMHWCLPG+TD WND+ V L
Sbjct: 360 VLDITRMSEYRADAHPAAAGGKNHDDCMHWCLPGLTDTWNDLFVATL 406


>tr|A7QSB5|A7QSB5_VITVI Chromosome chr3 scaffold_157, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00005760001
PE=4 SV=1
Length = 413

Score = 172 bits (435), Expect = 1e-41
Identities = 78/168 (46%), Positives = 114/168 (67%), Gaps = 6/168 (3%)
Frame = -2

Query: 514 WWAPEKFDPVKTPMIFFEKGEPIIPTKPPEEGLDMVLKSMIAYVEQRMPAEGLMFLRMQS 335
WW P+KF P + P++F++ G+P++P +G +VLK+M++Y+++++P++ L F R+QS
Sbjct: 233 WWGPDKF-PKEKPLVFYKAGKPLLPLLGMHDGFKVVLKNMVSYIQKKVPSKTLKFWRLQS 291

Query: 334 PRHFEGGDWNEGGSCHRSKPLTEEEAKTWFALSGKPGPNVEMSKANLHLEKAIQGTKFEL 155
PRHF GGDWN+ GSC KPL E + WF G N E + NL +E+A+QGT +L
Sbjct: 292 PRHFYGGDWNQNGSCLFDKPLEESQLDLWFDPRNN-GVNKEARQLNLLIEEALQGTDIQL 350

Query: 154 LNISYLSSLRADAHPSLSAGKLH------EDCMHWCLPGVTDIWNDML 29
L++++LS RADAHPS+ GK +DCMHWCLPGV D W D+L
Sbjct: 351 LDLTHLSEFRADAHPSIWLGKKDAVAEWGQDCMHWCLPGVPDTWVDIL 398


>tr|Q9FGE9|Q9FGE9_ARATH Gb|AAD15463.1 (Putative uncharacterized
protein At5g64470) OS=Arabidopsis thaliana GN=At5g64470
PE=2 SV=1
Length = 407

Score = 164 bits (415), Expect = 2e-39
Identities = 78/173 (45%), Positives = 111/173 (64%), Gaps = 6/173 (3%)
Frame = -2

Query: 514 WWAPEKFDPVKTPMIFFEKGEPIIPTKPPEEGLDMVLKSMIAYVEQRMPAEGLMFLRMQS 335
WW +KF P +TP++F+ KG+PI P G ++VL++M++Y+++ +PA+ L F R+QS
Sbjct: 231 WWGYDKF-PKETPLVFYRKGKPINPPLDILPGFELVLQNMVSYIQREVPAKTLKFWRLQS 289

Query: 334 PRHFEGGDWNEGGSCHRSKPLTEEEAKTWFALSGKPGPNVEMSKANLHLEKAIQGTKFEL 155
PRHF GGDWN+ GSC KPL E + WF G N E K N ++ +Q TK +L
Sbjct: 290 PRHFYGGDWNQNGSCLLDKPLEENQLDLWFDPRNN-GVNKEARKINQIIKNELQTTKIKL 348

Query: 154 LNISYLSSLRADAHPSLSAGKLH------EDCMHWCLPGVTDIWNDMLVRRLL 14
L++++LS RADAHP++ GK +DCMHWCLPGV D W D+L +L
Sbjct: 349 LDLTHLSEFRADAHPAIWLGKQDAVAIWGQDCMHWCLPGVPDTWVDILAELIL 401


>tr|Q6ZGL3|Q6ZGL3_ORYSJ Os02g0117900 protein OS=Oryza sativa subsp.
japonica GN=OJ1442_E05.33 PE=2 SV=1
Length = 403

Score = 155 bits (392), Expect = 1e-36
Identities = 77/173 (44%), Positives = 107/173 (61%), Gaps = 6/173 (3%)
Frame = -2

Query: 514 WWAPEKFDPVKTPMIFFEKGEPIIPTKPPEEGLDMVLKSMIAYVEQRMPAEGLMFLRMQS 335
WW +KF P +TP++F+ G+PI P +GL +VLKSM +Y+E+ +P++ L R QS
Sbjct: 225 WWGLDKF-PKETPLVFYRGGKPIEPPLGIYDGLKVVLKSMASYIEREVPSKTLKLWRSQS 283

Query: 334 PRHFEGGDWNEGGSCHRSKPLTEEEAKTWFALSGKPGPNVEMSKANLHLEKAIQGTKFEL 155
PRHF GG+W+ GSC + L E E WF G N E N +++A+ GT +L
Sbjct: 284 PRHFYGGEWDHNGSCVSDRLLQEHELDLWFD-PRFGGVNKEARLVNSAIQEALIGTDIQL 342

Query: 154 LNISYLSSLRADAHPSLSAGKLH------EDCMHWCLPGVTDIWNDMLVRRLL 14
LN++Y+S RADAHP++ GK +DCMHWCLPGV D W D+L R+L
Sbjct: 343 LNLTYMSEFRADAHPAIWLGKKDAVAVWGQDCMHWCLPGVPDTWVDILAARIL 395


>tr|A3A2G9|A3A2G9_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_004991 PE=4 SV=1
Length = 773

Score = 155 bits (392), Expect = 1e-36
Identities = 77/173 (44%), Positives = 107/173 (61%), Gaps = 6/173 (3%)
Frame = -2

Query: 514 WWAPEKFDPVKTPMIFFEKGEPIIPTKPPEEGLDMVLKSMIAYVEQRMPAEGLMFLRMQS 335
WW +KF P +TP++F+ G+PI P +GL +VLKSM +Y+E+ +P++ L R QS
Sbjct: 595 WWGLDKF-PKETPLVFYRGGKPIEPPLGIYDGLKVVLKSMASYIEREVPSKTLKLWRSQS 653

Query: 334 PRHFEGGDWNEGGSCHRSKPLTEEEAKTWFALSGKPGPNVEMSKANLHLEKAIQGTKFEL 155
PRHF GG+W+ GSC + L E E WF G N E N +++A+ GT +L
Sbjct: 654 PRHFYGGEWDHNGSCVSDRLLQEHELDLWFD-PRFGGVNKEARLVNSAIQEALIGTDIQL 712

Query: 154 LNISYLSSLRADAHPSLSAGKLH------EDCMHWCLPGVTDIWNDMLVRRLL 14
LN++Y+S RADAHP++ GK +DCMHWCLPGV D W D+L R+L
Sbjct: 713 LNLTYMSEFRADAHPAIWLGKKDAVAVWGQDCMHWCLPGVPDTWVDILAARIL 765