BP916548
Clone id YMU001_000088_H06
Library
Length 451
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000088_H06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CGTAACTTCTTGTGCTTCTCTATCAAGCTGAAAACTAGCAGCATCTTTCCCTTTGTAATG
CTTCAATGCCCACTGCAACTCTCTGACTGCTCCCTGTAGTATTGACATAGCATCGGCTGT
ATCAGCTCTTTCAATTTCAAGCAACTTGATCAAGTCTTCATTGTCCCTCGTGGGCAAAAG
TTCTCTTTCACCCCAGTCTTCTCCACTCTCAAGTATCGTGCTATGTTCTTCTAGGACTTT
TGGTTCGACTCGCTCGTGTATCCATGCTACCTTCCTCTCAGAGTCTCGTTCTAACCTTGC
CCTTTGAAGTTCCTTTTCCTTTGCGTTTAGCTCTTCTTTGAGACTGTGGATAGCCAGCAT
TGCCTCAGCTATTTGATTATCAAAGCCTGCAATTTTACTAATCAAATCTTGCCATTCTAC
ATCTCTTCTGCCACCAAAACCACTAGTTTGG
■■Homology search results ■■ -
sp_hit_id P55080
Definition sp|P55080|MFAP1_CHICK Microfibrillar-associated protein 1 OS=Gallus gallus
Align length 99
Score (bit) 31.2
E-value 2.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916548|Adiantum capillus-veneris mRNA, clone:
YMU001_000088_H06.
(451 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P55080|MFAP1_CHICK Microfibrillar-associated protein 1 OS=Gal... 31 2.2
sp|Q99661|KIF2C_HUMAN Kinesin-like protein KIF2C OS=Homo sapiens... 31 2.8
sp|Q99996|AKAP9_HUMAN A-kinase anchor protein 9 OS=Homo sapiens ... 30 3.7
sp|Q7RTP6|MICA3_HUMAN Protein MICAL-3 OS=Homo sapiens GN=MICAL3 ... 30 6.3
sp|Q9R1K8|GRP1_RAT RAS guanyl-releasing protein 1 OS=Rattus norv... 30 6.3
sp|Q9Z1S3|GRP1_MOUSE RAS guanyl-releasing protein 1 OS=Mus muscu... 30 6.3
sp|O95267|GRP1_HUMAN RAS guanyl-releasing protein 1 OS=Homo sapi... 30 6.3
sp|Q8RFY7|GSA_FUSNN Glutamate-1-semialdehyde 2,1-aminomutase OS=... 29 8.2

>sp|P55080|MFAP1_CHICK Microfibrillar-associated protein 1 OS=Gallus
gallus GN=MFAP1 PE=2 SV=1
Length = 442

Score = 31.2 bits (69), Expect = 2.2
Identities = 25/99 (25%), Positives = 41/99 (41%)
Frame = -2

Query: 297 RLERDSERKVAWIHERVEPKVLEEHSTILESGEDWGERELLPTRDNEDLIKLLEIERADT 118
R+ D E ++A + VEP+V+ S GE W + + E+ I EIER
Sbjct: 94 RITEDVEERLARHRKIVEPEVVSGESDSEVEGEAWRVEREDTSEEEEEEIDDEEIERWRG 153

Query: 117 ADAMSILQGAVRELQWALKHYKGKDAASFQLDREAQEVT 1
+ EL+ +G+ +L+ E +E T
Sbjct: 154 MMRQRAQERKTEELEVMELEDEGRSGEESELESEYEEYT 192


>sp|Q99661|KIF2C_HUMAN Kinesin-like protein KIF2C OS=Homo sapiens
GN=KIF2C PE=1 SV=2
Length = 725

Score = 30.8 bits (68), Expect = 2.8
Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 3/66 (4%)
Frame = -2

Query: 249 VEPKVLEEHSTILESGEDW---GERELLPTRDNEDLIKLLEIERADTADAMSILQGAVRE 79
+E K +EE I++ G DW E P D E + E A A S L+ ++
Sbjct: 644 LEEKAMEELKEIIQQGPDWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSALRDVIKA 703

Query: 78 LQWALK 61
L+ A++
Sbjct: 704 LRLAMQ 709


>sp|Q99996|AKAP9_HUMAN A-kinase anchor protein 9 OS=Homo sapiens
GN=AKAP9 PE=1 SV=3
Length = 3911

Score = 30.4 bits (67), Expect = 3.7
Identities = 27/90 (30%), Positives = 39/90 (43%), Gaps = 2/90 (2%)
Frame = -2

Query: 270 VAWIHERVEPKVLEEHSTILESGEDWGEREL--LPTRDNEDLIKLLEIERADTADAMSIL 97
VA + + LE +T+ + E E L +D D + LL D ++
Sbjct: 3165 VAELKSELAQTKLELETTLKAQHKHLKELEAFRLEVKDKTDEVHLLN-------DTLASE 3217

Query: 96 QGAVRELQWALKHYKGKDAASFQLDREAQE 7
Q RELQWAL+ K K S + D+E E
Sbjct: 3218 QKKSRELQWALEKEKAKLGRSEERDKEELE 3247


>sp|Q7RTP6|MICA3_HUMAN Protein MICAL-3 OS=Homo sapiens GN=MICAL3
PE=1 SV=1
Length = 976

Score = 29.6 bits (65), Expect = 6.3
Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 3/66 (4%)
Frame = -2

Query: 219 TILESG---EDWGERELLPTRDNEDLIKLLEIERADTADAMSILQGAVRELQWALKHYKG 49
++L+ G D+ + ELL +R+N D LL R + AD + Q + L +A+ HY
Sbjct: 307 SLLDKGVILHDYADTELLLSRENVDQEALLSYAR-EAADFST--QQQLPSLDFAINHYGQ 363

Query: 48 KDAASF 31
D A F
Sbjct: 364 PDVAMF 369


>sp|Q9R1K8|GRP1_RAT RAS guanyl-releasing protein 1 OS=Rattus
norvegicus GN=Rasgrp1 PE=1 SV=1
Length = 795

Score = 29.6 bits (65), Expect = 6.3
Identities = 13/33 (39%), Positives = 20/33 (60%)
Frame = -2

Query: 306 QRARLERDSERKVAWIHERVEPKVLEEHSTILE 208
QR + +RKV+ + + +EP+ L EH T LE
Sbjct: 185 QRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLE 217


>sp|Q9Z1S3|GRP1_MOUSE RAS guanyl-releasing protein 1 OS=Mus musculus
GN=Rasgrp1 PE=1 SV=1
Length = 795

Score = 29.6 bits (65), Expect = 6.3
Identities = 13/33 (39%), Positives = 20/33 (60%)
Frame = -2

Query: 306 QRARLERDSERKVAWIHERVEPKVLEEHSTILE 208
QR + +RKV+ + + +EP+ L EH T LE
Sbjct: 185 QRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLE 217


>sp|O95267|GRP1_HUMAN RAS guanyl-releasing protein 1 OS=Homo sapiens
GN=RASGRP1 PE=1 SV=2
Length = 797

Score = 29.6 bits (65), Expect = 6.3
Identities = 13/33 (39%), Positives = 20/33 (60%)
Frame = -2

Query: 306 QRARLERDSERKVAWIHERVEPKVLEEHSTILE 208
QR + +RKV+ + + +EP+ L EH T LE
Sbjct: 185 QRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLE 217


>sp|Q8RFY7|GSA_FUSNN Glutamate-1-semialdehyde 2,1-aminomutase
OS=Fusobacterium nucleatum subsp. nucleatum GN=hemL PE=3
SV=1
Length = 434

Score = 29.3 bits (64), Expect = 8.2
Identities = 15/35 (42%), Positives = 22/35 (62%)
Frame = -2

Query: 243 PKVLEEHSTILESGEDWGERELLPTRDNEDLIKLL 139
PKV+EE I+E+G +G LPT+ DL +L+
Sbjct: 72 PKVIEEVKKIIENGSSYG----LPTKYEVDLAELI 102


tr_hit_id A9RMY8
Definition tr|A9RMY8|A9RMY8_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 123
Score (bit) 49.7
E-value 7.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916548|Adiantum capillus-veneris mRNA, clone:
YMU001_000088_H06.
(451 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RMY8|A9RMY8_PHYPA Predicted protein OS=Physcomitrella paten... 50 7e-05
tr|A9RGU3|A9RGU3_PHYPA Predicted protein OS=Physcomitrella paten... 45 0.002
tr|Q8P3N3|Q8P3N3_XANCP Cation efflux system protein OS=Xanthomon... 35 2.5
tr|Q4UP57|Q4UP57_XANC8 Cation efflux system protein OS=Xanthomon... 35 2.5
tr|B2V941|B2V941_SULSY Efflux transporter, RND family, MFP subun... 35 2.5
tr|Q1QXH2|Q1QXH2_CHRSD Transcriptional regulator, ArsR family OS... 34 4.2
tr|Q7PV87|Q7PV87_ANOGA AGAP012090-PA (Fragment) OS=Anopheles gam... 33 5.5
tr|A5IZ70|A5IZ70_MYCAP Putative uncharacterized protein OS=Mycop... 33 7.1
tr|A1L275|A1L275_DANRE LOC557688 protein (Fragment) OS=Danio rer... 33 9.3

>tr|A9RMY8|A9RMY8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_160045 PE=4 SV=1
Length = 1257

Score = 49.7 bits (117), Expect = 7e-05
Identities = 36/123 (29%), Positives = 64/123 (52%), Gaps = 5/123 (4%)
Frame = -2

Query: 411 QDLISKIAGFDNQIAEAMLAIHSXXXXXXXXXXXLQRARLERDSERKVAWIHERVEPKVL 232
Q + ++A D QI EAM AI S L +A++++++E W ER + ++
Sbjct: 708 QAAVCRVANVDKQIEEAMDAIVSLREELDNKETQLIQAKMDKEAE----W--ERRQAALV 761

Query: 231 EEHSTILESGED-----WGERELLPTRDNEDLIKLLEIERADTADAMSILQGAVRELQWA 67
+E+ +L E W +E N+ ++ L ER +TA +++GA+REL+W+
Sbjct: 762 QEYKEMLSMREQKWQQGWMRKEQELLAANDKILHQLADERGETA----LVRGALRELEWS 817

Query: 66 LKH 58
+KH
Sbjct: 818 IKH 820


>tr|A9RGU3|A9RGU3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_65935 PE=4 SV=1
Length = 1436

Score = 45.1 bits (105), Expect = 0.002
Identities = 38/133 (28%), Positives = 62/133 (46%), Gaps = 5/133 (3%)
Frame = -2

Query: 441 GFGGRRDVEWQDLISKIAGFDNQIAEAMLAIHSXXXXXXXXXXXLQRARLERDSERKVAW 262
G + D + Q ++ D QI EAM I S L+ A+ ++ E W
Sbjct: 945 GIDCQDDFDSQAADFRVVNVDIQIEEAMNEIESLREELDNKETQLKHAKKVKEIE----W 1000

Query: 261 IHERVEPKVLEEHSTILESGED-----WGERELLPTRDNEDLIKLLEIERADTADAMSIL 97
ER + ++EE+ +L+ E W +E N+ ++ L +R +TA I+
Sbjct: 1001 --ERRQAALIEEYEDMLDMREQELQQVWMRKEQELLSANDKILHQLADQRGETA----IV 1054

Query: 96 QGAVRELQWALKH 58
QGA+REL+W +KH
Sbjct: 1055 QGALRELEWFIKH 1067


>tr|Q8P3N3|Q8P3N3_XANCP Cation efflux system protein OS=Xanthomonas
campestris pv. campestris GN=czcC PE=4 SV=1
Length = 421

Score = 34.7 bits (78), Expect = 2.5
Identities = 37/146 (25%), Positives = 65/146 (44%), Gaps = 3/146 (2%)
Frame = -2

Query: 429 RRDVEWQDLISKIAGFDNQ--IAEAMLAIHSXXXXXXXXXXXLQRARLE-RDSERKVAWI 259
R D++WQ + ++ G D + LA+ S RAR E R +E +++ +
Sbjct: 268 RPDLDWQVGVRRLQGSDATALVGGVSLALGSAA-----------RARPEIRAAEAELSLL 316

Query: 258 HERVEPKVLEEHSTILESGEDWGERELLPTRDNEDLIKLLEIERADTADAMSILQGAVRE 79
+ +VL ++T+ ++ + +L +R ED++ L RAD A + GA
Sbjct: 317 DIERQSQVLVLYTTLADAHGRYRAAQLEVSRMREDVLPALA--RADAAAERAYRAGATSY 374

Query: 78 LQWALKHYKGKDAASFQLDREAQEVT 1
L WA + DA QL ++ T
Sbjct: 375 LDWAQLQAQHNDARQQQLAAASEAQT 400


>tr|Q4UP57|Q4UP57_XANC8 Cation efflux system protein OS=Xanthomonas
campestris pv. campestris (strain 8004) GN=XC_4127 PE=4
SV=1
Length = 421

Score = 34.7 bits (78), Expect = 2.5
Identities = 37/146 (25%), Positives = 65/146 (44%), Gaps = 3/146 (2%)
Frame = -2

Query: 429 RRDVEWQDLISKIAGFDNQ--IAEAMLAIHSXXXXXXXXXXXLQRARLE-RDSERKVAWI 259
R D++WQ + ++ G D + LA+ S RAR E R +E +++ +
Sbjct: 268 RPDLDWQVGVRRLQGSDATALVGGVSLALGSAA-----------RARPEIRAAEAELSLL 316

Query: 258 HERVEPKVLEEHSTILESGEDWGERELLPTRDNEDLIKLLEIERADTADAMSILQGAVRE 79
+ +VL ++T+ ++ + +L +R ED++ L RAD A + GA
Sbjct: 317 DIERQSQVLVLYTTLADAHGRYRAAQLEVSRMREDVLPALA--RADAAAERAYRAGATSY 374

Query: 78 LQWALKHYKGKDAASFQLDREAQEVT 1
L WA + DA QL ++ T
Sbjct: 375 LDWAQLQAQHNDARQQQLAAASEAQT 400


>tr|B2V941|B2V941_SULSY Efflux transporter, RND family, MFP subunit
OS=Sulfurihydrogenibium sp. (strain YO3AOP1)
GN=SYO3AOP1_0831 PE=4 SV=1
Length = 372

Score = 34.7 bits (78), Expect = 2.5
Identities = 19/67 (28%), Positives = 34/67 (50%)
Frame = -2

Query: 240 KVLEEHSTILESGEDWGERELLPTRDNEDLIKLLEIERADTADAMSILQGAVRELQWALK 61
KV E + E G L+P +++ K LE+ + D A++ Q +++EL + LK
Sbjct: 133 KVYERRKNLFEKG-------LIPKEQFDEVAKNLEVAKRDYEKAVASYQDSLKELSYQLK 185

Query: 60 HYKGKDA 40
++ K A
Sbjct: 186 SFEAKKA 192


>tr|Q1QXH2|Q1QXH2_CHRSD Transcriptional regulator, ArsR family
OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC
BAA-138 / NCIMB 13768) GN=Csal_1483 PE=4 SV=1
Length = 135

Score = 33.9 bits (76), Expect = 4.2
Identities = 20/44 (45%), Positives = 28/44 (63%)
Frame = -2

Query: 306 QRARLERDSERKVAWIHERVEPKVLEEHSTILESGEDWGERELL 175
+RA L RD R+ AWI+ R+EP + E STILE+ D E++
Sbjct: 57 RRAGLLRD-RRRGAWIYYRLEPTLPEWVSTILEASRDAAPPEVI 99


>tr|Q7PV87|Q7PV87_ANOGA AGAP012090-PA (Fragment) OS=Anopheles
gambiae GN=AGAP012090 PE=4 SV=4
Length = 1642

Score = 33.5 bits (75), Expect = 5.5
Identities = 29/89 (32%), Positives = 46/89 (51%), Gaps = 4/89 (4%)
Frame = -2

Query: 306 QRARLERDSERKVAWIHERVEPKVLEEHSTILESGEDWGERELLPTRDNEDLIKLLEIER 127
++ RL DS RK+ + E +L + + LES ER ++NE +I+LL E+
Sbjct: 394 EKQRLSPDSTRKL-----QDEINILTKRNCELESQIKSFERVDAKIKENEKMIRLLRQEK 448

Query: 126 ADTA----DAMSILQGAVRELQWALKHYK 52
D A DA+ L+ +EL+ AL+ K
Sbjct: 449 EDLAKEHQDALDRLKQQDKELKDALEQRK 477


>tr|A5IZ70|A5IZ70_MYCAP Putative uncharacterized protein
OS=Mycoplasma agalactiae (strain PG2) GN=MAG6290 PE=4
SV=1
Length = 934

Score = 33.1 bits (74), Expect = 7.1
Identities = 24/72 (33%), Positives = 41/72 (56%), Gaps = 1/72 (1%)
Frame = -2

Query: 276 RKVAWIHERVEPKVLEEH-STILESGEDWGERELLPTRDNEDLIKLLEIERADTADAMSI 100
R+ A+IH + K + + +TI SGE GE ++ R+NE L LLE++ +T S+
Sbjct: 439 REYAYIHYNQQAKAISFYCNTIERSGEQNGET-MMVVRNNEMLEGLLELKEENTISKFSV 497

Query: 99 LQGAVRELQWAL 64
+ V+ L ++L
Sbjct: 498 -KSVVKYLAYSL 508


>tr|A1L275|A1L275_DANRE LOC557688 protein (Fragment) OS=Danio rerio
GN=LOC557688 PE=2 SV=1
Length = 931

Score = 32.7 bits (73), Expect = 9.3
Identities = 22/96 (22%), Positives = 54/96 (56%), Gaps = 1/96 (1%)
Frame = -2

Query: 306 QRARLERDSERKVAWIHERVEPKVLEEHSTILESGEDWGERELLPTRDNEDLIKLLEIER 127
Q+ ++E + ER + ++++ + E ++L+ E + L +DN ++IKL ++
Sbjct: 211 QQMQME-ELERSAEMMRDQLKRRDREFEESLLQVREQQASGQRLTIKDNVEMIKLQKL-L 268

Query: 126 ADTADAMSILQGAVRELQWALKHYKGK-DAASFQLD 22
++ A+ +++L+G + Q ++K K DAA +++
Sbjct: 269 SEKANTLAVLEGRFLQQQESMKTLKASHDAALLKVE 304