BP916553
Clone id YMU001_000089_A01
Library
Length 440
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000089_A01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CAGCTTTCTAGGTGTGTGCTACAGTCAATTGCCCACAGCAGATACTTGATTATTAATAGA
GCATTCCTTGACCTTATTGCATTCCCTGTCTCTCTTTCATACTTTCTCATTGTACTGCAA
GAATCACCTACCAAATAAACCACTTGCATGTAAATCTTTTTCTCATGTACATGGGGACGT
AGGTGAGGGGATCCAAACGGCGATGACTCTCTACTTACGGGTGATTCTGTCTTACTCTCA
CTATTCCTTTTGCTGGTTTAGGTGATCCCTGGCTTTTATCCACCTTGCAGTGGGAATGAG
CTTTGTCAAATGCAGATATGTTATTGATACTCCTACATGTAGAGTCACTCATTGGCTCTT
ACTTGCTCTCAGGAAAAACTCTCAATGCCTTGGACTCAGCAGGGGTTGTTGGGGGTGTCA
AAGACCCTCCATAATGAGTC
■■Homology search results ■■ -
sp_hit_id Q7ZUC7
Definition sp|Q7ZUC7|PGES2_DANRE Prostaglandin E synthase 2 OS=Danio rerio
Align length 31
Score (bit) 30.0
E-value 4.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916553|Adiantum capillus-veneris mRNA, clone:
YMU001_000089_A01.
(440 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q7ZUC7|PGES2_DANRE Prostaglandin E synthase 2 OS=Danio rerio ... 30 4.4
sp|P15533|TRI30_MOUSE Tripartite motif-containing protein 30 OS=... 29 7.5
sp|Q9D722|CT111_MOUSE Uncharacterized protein C20orf111 homolog ... 29 9.8

>sp|Q7ZUC7|PGES2_DANRE Prostaglandin E synthase 2 OS=Danio rerio
GN=ptges2 PE=2 SV=1
Length = 377

Score = 30.0 bits (66), Expect = 4.4
Identities = 13/31 (41%), Positives = 18/31 (58%)
Frame = +2

Query: 314 RYVIDTPTCRVTHWLLLALRKNSQCLGLSRG 406
R V+DTPTCR T+ R + +C G + G
Sbjct: 14 RLVLDTPTCRFTNTAAFVPRTSMRCQGRAYG 44


>sp|P15533|TRI30_MOUSE Tripartite motif-containing protein 30 OS=Mus
musculus GN=Trim30 PE=1 SV=2
Length = 496

Score = 29.3 bits (64), Expect = 7.5
Identities = 15/34 (44%), Positives = 20/34 (58%)
Frame = -1

Query: 254 SKRNSESKTESPVSRESSPFGSPHLRPHVHEKKI 153
S RN++ K PV R PFG +LRP++H I
Sbjct: 45 SNRNTDGKGNCPVCRVPYPFG--NLRPNLHVANI 76


>sp|Q9D722|CT111_MOUSE Uncharacterized protein C20orf111 homolog
OS=Mus musculus PE=2 SV=1
Length = 291

Score = 28.9 bits (63), Expect = 9.8
Identities = 18/48 (37%), Positives = 25/48 (52%)
Frame = -2

Query: 403 PAESKALRVFPESK*EPMSDSTCRSINNISAFDKAHSHCKVDKSQGSP 260
P S LR+ ESK E +SD+T S +++A D + SQG P
Sbjct: 149 PLRSSVLRLPSESKTEELSDATQVSQESLTANDLSDFQSVSKLSQGKP 196


tr_hit_id B3YPP9
Definition tr|B3YPP9|B3YPP9_BACCE Putative uncharacterized protein OS=Bacillus cereus W
Align length 58
Score (bit) 34.7
E-value 2.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916553|Adiantum capillus-veneris mRNA, clone:
YMU001_000089_A01.
(440 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B3YPP9|B3YPP9_BACCE Putative uncharacterized protein OS=Bacil... 35 2.4
tr|Q8LFM8|Q8LFM8_ARATH Putative uncharacterized protein OS=Arabi... 33 9.2

>tr|B3YPP9|B3YPP9_BACCE Putative uncharacterized protein OS=Bacillus
cereus W GN=BCW_4671 PE=4 SV=1
Length = 174

Score = 34.7 bits (78), Expect = 2.4
Identities = 19/58 (32%), Positives = 28/58 (48%)
Frame = -1

Query: 239 ESKTESPVSRESSPFGSPHLRPHVHEKKIYMQVVYLVGDSCSTMRKYERETGNAIRSR 66
E+ E P+S G L+ H+HE+ +Y G +C + YER TGN S+
Sbjct: 13 ENLREKPISLAEMKQGIVFLKEHLHERSLY-------GKNCGLIGVYERITGNLSDSK 63


>tr|Q8LFM8|Q8LFM8_ARATH Putative uncharacterized protein
OS=Arabidopsis thaliana PE=2 SV=1
Length = 287

Score = 32.7 bits (73), Expect = 9.2
Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 1/69 (1%)
Frame = -2

Query: 436 HYGGSLTPPTTPAESKAL-RVFPESK*EPMSDSTCRSINNISAFDKAHSHCKVDKSQGSP 260
H G+LTP +T + +L V ES P+ +S C N S D +CK+ K P
Sbjct: 145 HKYGALTPDSTTKGTVSLGSVDKESNNHPLINSPC---NLRSVVDSRLENCKLSKDVPPP 201

Query: 259 KPAKGIVRV 233
KP + + ++
Sbjct: 202 KPLRDVNQI 210