BP916568
Clone id YMU001_000089_B04
Library
Length 508
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000089_B04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
AGAACAAGGAGCTGCTCACGATATTTTGATAGCCAAGGTTGGGCTTGATCTGGACCTCTT
TGTGTGTAGCATTGTTTTGGACATGTACATGAAATGTGGGAGTGTGGAGGATGGTCAAAA
AGTGTTCAATAACATGTTGAGGCATGATAGTGTTGCGTGGGGTACATTGATTGCAGGCTA
CATTGAACAGGCAAGGACTAAAGAGGCATTGGAACTCTTTGAAGAAATGCAGAGAGAAGG
CTCACATCCAAGTTTATACACTATCATTTGTCTGTTAAAGGCATGCTCTAAAATGGGGGC
AATTGATCAAGGGAAGGAACTACATTCATTGGGAGTAAAATTTAGGTATGAGTGTGACCT
ATATTTTTGTAATGTGCTAATTGGTATGTATGCGAAAAGTGGGAATTTAGAGGATTCCCA
GAAAGTTTTTGATCAAACGTCCAAACGGGATGTAGTTACATGGAGTGAACTTATTTCAGG
TTATAGTGAACATGAAGACTATGATGCC
■■Homology search results ■■ -
sp_hit_id Q9LIQ7
Definition sp|Q9LIQ7|PP252_ARATH Pentatricopeptide repeat-containing protein At3g24000, mitochondrial OS=Arabidopsis thaliana
Align length 153
Score (bit) 130.0
E-value 4.0e-30
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916568|Adiantum capillus-veneris mRNA, clone:
YMU001_000089_B04.
(508 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9LIQ7|PP252_ARATH Pentatricopeptide repeat-containing protei... 130 4e-30
sp|Q9SVA5|PP357_ARATH Pentatricopeptide repeat-containing protei... 128 2e-29
sp|Q9SI53|PP147_ARATH Pentatricopeptide repeat-containing protei... 124 3e-28
sp|Q9FM64|PP431_ARATH Pentatricopeptide repeat-containing protei... 123 6e-28
sp|Q3E6Q1|PPR32_ARATH Pentatricopeptide repeat-containing protei... 119 1e-26
sp|Q9ZUT4|PP192_ARATH Pentatricopeptide repeat-containing protei... 119 1e-26
sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protei... 118 2e-26
sp|Q9ZUW3|PP172_ARATH Pentatricopeptide repeat-containing protei... 117 2e-26
sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protei... 116 5e-26
sp|O64705|PP184_ARATH Pentatricopeptide repeat-containing protei... 116 5e-26
sp|Q9LZ19|PP364_ARATH Pentatricopeptide repeat-containing protei... 116 7e-26
sp|P93005|PP181_ARATH Pentatricopeptide repeat-containing protei... 116 7e-26
sp|Q9LW63|PP251_ARATH Putative pentatricopeptide repeat-containi... 115 9e-26
sp|Q9SS60|PP210_ARATH Pentatricopeptide repeat-containing protei... 115 2e-25
sp|Q9M9E2|PPR45_ARATH Pentatricopeptide repeat-containing protei... 114 2e-25
sp|Q9XE98|PP303_ARATH Pentatricopeptide repeat-containing protei... 114 2e-25
sp|Q9SUH6|PP341_ARATH Pentatricopeptide repeat-containing protei... 114 3e-25
sp|A8MQA3|PP330_ARATH Pentatricopeptide repeat-containing protei... 114 3e-25
sp|O82380|PP175_ARATH Pentatricopeptide repeat-containing protei... 114 3e-25
sp|Q0WNP3|PP319_ARATH Pentatricopeptide repeat-containing protei... 113 5e-25
sp|Q7Y211|PP285_ARATH Pentatricopeptide repeat-containing protei... 112 1e-24
sp|Q9SMZ2|PP347_ARATH Pentatricopeptide repeat-containing protei... 112 1e-24
sp|Q9LRV9|PP228_ARATH Pentatricopeptide repeat-containing protei... 112 1e-24
sp|O23337|PP311_ARATH Pentatricopeptide repeat-containing protei... 111 2e-24
sp|Q9FWA6|PP207_ARATH Pentatricopeptide repeat-containing protei... 111 2e-24
sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protei... 110 4e-24
sp|Q9LTV8|PP224_ARATH Pentatricopeptide repeat-containing protei... 110 4e-24
sp|Q9CA56|PP121_ARATH Pentatricopeptide repeat-containing protei... 110 5e-24
sp|Q9LYV3|PP377_ARATH Putative pentatricopeptide repeat-containi... 109 7e-24
sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protei... 109 7e-24

>sp|Q9LIQ7|PP252_ARATH Pentatricopeptide repeat-containing protein
At3g24000, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-H87 PE=2 SV=1
Length = 633

Score = 130 bits (327), Expect = 4e-30
Identities = 61/153 (39%), Positives = 102/153 (66%)
Frame = +2

Query: 35 KVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALE 214
K G D ++ V S +LD+Y + G ++D Q VF+ + + V+W LIAG+ ++ T++ALE
Sbjct: 189 KCGFDSNVHVGSALLDLYTRYGLMDDAQLVFDALESRNDVSWNALIAGHARRSGTEKALE 248

Query: 215 LFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYA 394
LF+ M R+G PS ++ L ACS G ++QGK +H+ +K + + N L+ MYA
Sbjct: 249 LFQGMLRDGFRPSHFSYASLFGACSSTGFLEQGKWVHAYMIKSGEKLVAFAGNTLLDMYA 308

Query: 395 KSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
KSG++ D++K+FD+ +KRDVV+W+ L++ Y++H
Sbjct: 309 KSGSIHDARKIFDRLAKRDVVSWNSLLTAYAQH 341



Score = 103 bits (256), Expect = 6e-22
Identities = 51/145 (35%), Positives = 89/145 (61%)
Frame = +2

Query: 53 DLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALELFEEMQ 232
D+ + + +L+MY KCGS+E+ +KVF M + D V W TLI+GY + R +AL F +M
Sbjct: 94 DIVMGNTLLNMYAKCGSLEEARKVFEKMPQRDFVTWTTLISGYSQHDRPCDALLFFNQML 153

Query: 233 REGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYAKSGNLE 412
R G P+ +T+ ++KA + G +LH VK ++ +++ + L+ +Y + G ++
Sbjct: 154 RFGYSPNEFTLSSVIKAAAAERRGCCGHQLHGFCVKCGFDSNVHVGSALLDLYTRYGLMD 213

Query: 413 DSQKVFDQTSKRDVVTWSELISGYS 487
D+Q VFD R+ V+W+ LI+G++
Sbjct: 214 DAQLVFDALESRNDVSWNALIAGHA 238



Score = 84.0 bits (206), Expect = 4e-16
Identities = 46/167 (27%), Positives = 85/167 (50%), Gaps = 1/167 (0%)
Frame = +2

Query: 2 EQGAAHDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGY 181
EQG + K G L F + +LDMY K GS+ D +K+F+ + + D V+W +L+ Y
Sbjct: 279 EQGKWVHAYMIKSGEKLVAFAGNTLLDMYAKSGSIHDARKIFDRLAKRDVVSWNSLLTAY 338

Query: 182 IEQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDL 361
+ KEA+ FEEM+R G P+ + + +L ACS G +D+G + L K +
Sbjct: 339 AQHGFGKEAVWWFEEMRRVGIRPNEISFLSVLTACSHSGLLDEGWHYYELMKKDGIVPEA 398

Query: 362 YFCNVLIGMYAKSGNLEDSQKVFDQTS-KRDVVTWSELISGYSEHED 499
+ ++ + ++G+L + + ++ + W L++ H++
Sbjct: 399 WHYVTVVDLLGRAGDLNRALRFIEEMPIEPTAAIWKALLNACRMHKN 445



Score = 70.1 bits (170), Expect = 6e-12
Identities = 32/75 (42%), Positives = 52/75 (69%)
Frame = +2

Query: 272 LLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYAKSGNLEDSQKVFDQTSKRD 451
LLK C+ + QG+ +H+ ++ + D+ N L+ MYAK G+LE+++KVF++ +RD
Sbjct: 66 LLKKCTVFKLLIQGRIVHAHILQSIFRHDIVMGNTLLNMYAKCGSLEEARKVFEKMPQRD 125

Query: 452 VVTWSELISGYSEHE 496
VTW+ LISGYS+H+
Sbjct: 126 FVTWTTLISGYSQHD 140


>sp|Q9SVA5|PP357_ARATH Pentatricopeptide repeat-containing protein
At4g39530 OS=Arabidopsis thaliana GN=PCMP-E52 PE=1 SV=1
Length = 834

Score = 128 bits (321), Expect = 2e-29
Identities = 60/156 (38%), Positives = 93/156 (59%)
Frame = +2

Query: 26 LIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKE 205
L+ K GL+LD+F S ++D+Y C ++D + VF+ M D V W ++ AGY++Q+ +E
Sbjct: 479 LMFKYGLNLDIFAGSALIDVYSNCYCLKDSRLVFDEMKVKDLVIWNSMFAGYVQQSENEE 538

Query: 206 ALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIG 385
AL LF E+Q P +T ++ A + ++ G+E H +K EC+ Y N L+
Sbjct: 539 ALNLFLELQLSRERPDEFTFANMVTAAGNLASVQLGQEFHCQLLKRGLECNPYITNALLD 598

Query: 386 MYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
MYAK G+ ED+ K FD + RDVV W+ +IS Y+ H
Sbjct: 599 MYAKCGSPEDAHKAFDSAASRDVVCWNSVISSYANH 634



Score = 117 bits (294), Expect = 2e-26
Identities = 58/153 (37%), Positives = 92/153 (60%)
Frame = +2

Query: 29 IAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEA 208
I + GL++D + ++++D Y+KCG V K+FN M + ++W TL++GY + A KEA
Sbjct: 275 ILRYGLEMDASLMNVLIDSYVKCGRVIAAHKLFNGMPNKNIISWTTLLSGYKQNALHKEA 334

Query: 209 LELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGM 388
+ELF M + G P +Y +L +C+ + A+ G ++H+ +K D Y N LI M
Sbjct: 335 MELFTSMSKFGLKPDMYACSSILTSCASLHALGFGTQVHAYTIKANLGNDSYVTNSLIDM 394

Query: 389 YAKSGNLEDSQKVFDQTSKRDVVTWSELISGYS 487
YAK L D++KVFD + DVV ++ +I GYS
Sbjct: 395 YAKCDCLTDARKVFDIFAAADVVLFNAMIEGYS 427



Score = 102 bits (255), Expect = 8e-22
Identities = 45/155 (29%), Positives = 94/155 (60%)
Frame = +2

Query: 29 IAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEA 208
+ K G D D++V ++++D Y+K G+++ + VF+ + +V W T+I+G ++ R+ +
Sbjct: 174 LVKSGFDRDVYVGTLLIDFYLKDGNIDYARLVFDALPEKSTVTWTTMISGCVKMGRSYVS 233

Query: 209 LELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGM 388
L+LF ++ + P Y + +L ACS + ++ GK++H+ +++ E D NVLI
Sbjct: 234 LQLFYQLMEDNVVPDGYILSTVLSACSILPFLEGGKQIHAHILRYGLEMDASLMNVLIDS 293

Query: 389 YAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
Y K G + + K+F+ +++++W+ L+SGY ++
Sbjct: 294 YVKCGRVIAAHKLFNGMPNKNIISWTTLLSGYKQN 328



Score = 95.5 bits (236), Expect = 1e-19
Identities = 53/161 (32%), Positives = 89/161 (55%), Gaps = 6/161 (3%)
Frame = +2

Query: 35 KVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIE---QARTKE 205
K L D +V + ++DMY KC + D +KVF+ D V + +I GY Q E
Sbjct: 378 KANLGNDSYVTNSLIDMYAKCDCLTDARKVFDIFAAADVVLFNAMIEGYSRLGTQWELHE 437

Query: 206 ALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIG 385
AL +F +M+ PSL T + LL+A + + ++ K++H L K+ D++ + LI
Sbjct: 438 ALNIFRDMRFRLIRPSLLTFVSLLRASASLTSLGLSKQIHGLMFKYGLNLDIFAGSALID 497

Query: 386 MYAKSGNLEDSQKVFDQTSKRDVVTWSELISGY---SEHED 499
+Y+ L+DS+ VFD+ +D+V W+ + +GY SE+E+
Sbjct: 498 VYSNCYCLKDSRLVFDEMKVKDLVIWNSMFAGYVQQSENEE 538



Score = 95.5 bits (236), Expect = 1e-19
Identities = 45/152 (29%), Positives = 84/152 (55%), Gaps = 1/152 (0%)
Frame = +2

Query: 29 IAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEA 208
+ K GL+ + ++ + +LDMY KCGS ED K F++ D V W ++I+ Y K+A
Sbjct: 581 LLKRGLECNPYITNALLDMYAKCGSPEDAHKAFDSAASRDVVCWNSVISSYANHGEGKKA 640

Query: 209 LELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGM 388
L++ E+M EG P+ T + +L ACS G ++ G + L ++F E + ++ +
Sbjct: 641 LQMLEKMMSEGIEPNYITFVGVLSACSHAGLVEDGLKQFELMLRFGIEPETEHYVCMVSL 700

Query: 389 YAKSGNLEDSQKVFDQ-TSKRDVVTWSELISG 481
++G L ++++ ++ +K + W L+SG
Sbjct: 701 LGRAGRLNKARELIEKMPTKPAAIVWRSLLSG 732



Score = 83.2 bits (204), Expect = 7e-16
Identities = 47/152 (30%), Positives = 85/152 (55%), Gaps = 5/152 (3%)
Frame = +2

Query: 41 GLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALELF 220
GL+LD ++ +I++++Y + G + +KVF M + V+W T+++ +E+L +F
Sbjct: 74 GLELDTYLSNILINLYSRAGGMVYARKVFEKMPERNLVSWSTMVSACNHHGIYEESLVVF 133

Query: 221 EEMQR-EGSHPSLYTIICLLKACSKMGAIDQGK----ELHSLGVKFRYECDLYFCNVLIG 385
E R P+ Y + ++ACS G +G+ +L S VK ++ D+Y +LI
Sbjct: 134 LEFWRTRKDSPNEYILSSFIQACS--GLDGRGRWMVFQLQSFLVKSGFDRDVYVGTLLID 191

Query: 386 MYAKSGNLEDSQKVFDQTSKRDVVTWSELISG 481
Y K GN++ ++ VFD ++ VTW+ +ISG
Sbjct: 192 FYLKDGNIDYARLVFDALPEKSTVTWTTMISG 223



Score = 48.9 bits (115), Expect = 1e-05
Identities = 19/62 (30%), Positives = 40/62 (64%)
Frame = +2

Query: 320 LHSLGVKFRYECDLYFCNVLIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEHED 499
+H + + E D Y N+LI +Y+++G + ++KVF++ +R++V+WS ++S + H
Sbjct: 66 VHGQIIVWGLELDTYLSNILINLYSRAGGMVYARKVFEKMPERNLVSWSTMVSACNHHGI 125

Query: 500 YD 505
Y+
Sbjct: 126 YE 127


>sp|Q9SI53|PP147_ARATH Pentatricopeptide repeat-containing protein
At2g03880, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-H44 PE=2 SV=1
Length = 630

Score = 124 bits (311), Expect = 3e-28
Identities = 61/155 (39%), Positives = 99/155 (63%)
Frame = +2

Query: 29 IAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEA 208
I K GL+ D+FV S ++D++ K G ED VF+ M+ D++ W ++I G+ + +R+ A
Sbjct: 185 IIKEGLESDVFVRSALIDVFAKLGEPEDALSVFDEMVTGDAIVWNSIIGGFAQNSRSDVA 244

Query: 209 LELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGM 388
LELF+ M+R G T+ +L+AC+ + ++ G + H VK Y+ DL N L+ M
Sbjct: 245 LELFKRMKRAGFIAEQATLTSVLRACTGLALLELGMQAHVHIVK--YDQDLILNNALVDM 302

Query: 389 YAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
Y K G+LED+ +VF+Q +RDV+TWS +ISG +++
Sbjct: 303 YCKCGSLEDALRVFNQMKERDVITWSTMISGLAQN 337



Score = 99.4 bits (246), Expect = 9e-21
Identities = 55/155 (35%), Positives = 89/155 (57%), Gaps = 9/155 (5%)
Frame = +2

Query: 38 VGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALEL 217
V D DL + + ++DMY KCGS+ED +VFN M D + W T+I+G + ++EAL+L
Sbjct: 287 VKYDQDLILNNALVDMYCKCGSLEDALRVFNQMKERDVITWSTMISGLAQNGYSQEALKL 346

Query: 218 FEEMQREGSHPSLYTIICLLKACSKMGAIDQG-------KELHSLG-VKFRYECDLYFCN 373
FE M+ G+ P+ TI+ +L ACS G ++ G K+L+ + V+ Y C
Sbjct: 347 FERMKSSGTKPNYITIVGVLFACSHAGLLEDGWYYFRSMKKLYGIDPVREHYGC------ 400

Query: 374 VLIGMYAKSGNLEDSQKVFDQTS-KRDVVTWSELI 475
+I + K+G L+D+ K+ ++ + D VTW L+
Sbjct: 401 -MIDLLGKAGKLDDAVKLLNEMECEPDAVTWRTLL 434



Score = 88.6 bits (218), Expect = 2e-17
Identities = 43/150 (28%), Positives = 88/150 (58%)
Frame = +2

Query: 56 LFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALELFEEMQR 235
+F+ +++++MY+K + D ++F+ M + + ++W T+I+ Y + ++ALEL M R
Sbjct: 96 MFLVNVLINMYVKFNLLNDAHQLFDQMPQRNVISWTTMISAYSKCKIHQKALELLVLMLR 155

Query: 236 EGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYAKSGNLED 415
+ P++YT +L++C+ M + + LH +K E D++ + LI ++AK G ED
Sbjct: 156 DNVRPNVYTYSSVLRSCNGMSDV---RMLHCGIIKEGLESDVFVRSALIDVFAKLGEPED 212

Query: 416 SQKVFDQTSKRDVVTWSELISGYSEHEDYD 505
+ VFD+ D + W+ +I G++++ D
Sbjct: 213 ALSVFDEMVTGDAIVWNSIIGGFAQNSRSD 242


>sp|Q9FM64|PP431_ARATH Pentatricopeptide repeat-containing protein
At5g55740, chloroplastic OS=Arabidopsis thaliana
GN=CRR21 PE=2 SV=1
Length = 830

Score = 123 bits (308), Expect = 6e-28
Identities = 56/152 (36%), Positives = 95/152 (62%)
Frame = +2

Query: 29 IAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEA 208
+ K GL+ +FV S + DMY KCG ++D KVF+ + ++VAW L+ GY++ + +EA
Sbjct: 199 VVKSGLEDCVFVASSLADMYGKCGVLDDASKVFDEIPDRNAVAWNALMVGYVQNGKNEEA 258

Query: 209 LELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGM 388
+ LF +M+++G P+ T+ L A + MG +++GK+ H++ + E D L+
Sbjct: 259 IRLFSDMRKQGVEPTRVTVSTCLSASANMGGVEEGKQSHAIAIVNGMELDNILGTSLLNF 318

Query: 389 YAKSGNLEDSQKVFDQTSKRDVVTWSELISGY 484
Y K G +E ++ VFD+ ++DVVTW+ +ISGY
Sbjct: 319 YCKVGLIEYAEMVFDRMFEKDVVTWNLIISGY 350



Score = 102 bits (254), Expect = 1e-21
Identities = 47/163 (28%), Positives = 93/163 (57%)
Frame = +2

Query: 2 EQGAAHDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGY 181
E+G + G++LD + + +L+ Y K G +E + VF+ M D V W +I+GY
Sbjct: 291 EEGKQSHAIAIVNGMELDNILGTSLLNFYCKVGLIEYAEMVFDRMFEKDVVTWNLIISGY 350

Query: 182 IEQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDL 361
++Q ++A+ + + M+ E T+ L+ A ++ + GKE+ ++ +E D+
Sbjct: 351 VQQGLVEDAIYMCQLMRLEKLKYDCVTLATLMSAAARTENLKLGKEVQCYCIRHSFESDI 410

Query: 362 YFCNVLIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSE 490
+ ++ MYAK G++ D++KVFD T ++D++ W+ L++ Y+E
Sbjct: 411 VLASTVMDMYAKCGSIVDAKKVFDSTVEKDLILWNTLLAAYAE 453



Score = 76.6 bits (187), Expect = 6e-14
Identities = 35/90 (38%), Positives = 56/90 (62%)
Frame = +2

Query: 53 DLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALELFEEMQ 232
D+ + S V+DMY KCGS+ D +KVF++ + D + W TL+A Y E + EAL LF MQ
Sbjct: 409 DIVLASTVMDMYAKCGSIVDAKKVFDSTVEKDLILWNTLLAAYAESGLSGEALRLFYGMQ 468

Query: 233 REGSHPSLYTIICLLKACSKMGAIDQGKEL 322
EG P++ T ++ + + G +D+ K++
Sbjct: 469 LEGVPPNVITWNLIILSLLRNGQVDEAKDM 498



Score = 65.9 bits (159), Expect = 1e-10
Identities = 38/136 (27%), Positives = 65/136 (47%)
Frame = +2

Query: 86 YMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALELFEEMQREGSHPSLYTI 265
Y KC ++E + +F+ + + +W +I + AL F EM P + +
Sbjct: 117 YAKCDALEIAEVLFSKLRVRNVFSWAAIIGVKCRIGLCEGALMGFVEMLENEIFPDNFVV 176

Query: 266 ICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYAKSGNLEDSQKVFDQTSK 445
+ KAC + G+ +H VK E ++ + L MY K G L+D+ KVFD+
Sbjct: 177 PNVCKACGALKWSRFGRGVHGYVVKSGLEDCVFVASSLADMYGKCGVLDDASKVFDEIPD 236

Query: 446 RDVVTWSELISGYSEH 493
R+ V W+ L+ GY ++
Sbjct: 237 RNAVAWNALMVGYVQN 252



Score = 62.0 bits (149), Expect = 2e-09
Identities = 33/154 (21%), Positives = 79/154 (51%), Gaps = 5/154 (3%)
Frame = +2

Query: 41 GLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNM----LRHDSVAWGTLIAGYIEQARTKEA 208
G+ ++ ++++ ++ G V++ + +F M + + ++W T++ G ++ ++EA
Sbjct: 471 GVPPNVITWNLIILSLLRNGQVDEAKDMFLQMQSSGIIPNLISWTTMMNGMVQNGCSEEA 530

Query: 209 LELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNV-LIG 385
+ +MQ G P+ ++I L AC+ + ++ G+ +H ++ L L+
Sbjct: 531 ILFLRKMQESGLRPNAFSITVALSACAHLASLHIGRTIHGYIIRNLQHSSLVSIETSLVD 590

Query: 386 MYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYS 487
MYAK G++ ++KVF ++ + +IS Y+
Sbjct: 591 MYAKCGDINKAEKVFGSKLYSELPLSNAMISAYA 624



Score = 56.2 bits (134), Expect = 9e-08
Identities = 32/122 (26%), Positives = 61/122 (50%), Gaps = 1/122 (0%)
Frame = +2

Query: 74 VLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALELFEEMQREGSHPS 253
++DMY KCG + +KVF + L + +I+ Y KEA+ L+ ++ G P
Sbjct: 588 LVDMYAKCGDINKAEKVFGSKLYSELPLSNAMISAYALYGNLKEAIALYRSLEGVGLKPD 647

Query: 254 LYTIICLLKACSKMGAIDQGKELHS-LGVKFRYECDLYFCNVLIGMYAKSGNLEDSQKVF 430
TI +L AC+ G I+Q E+ + + K + L +++ + A +G E + ++
Sbjct: 648 NITITNVLSACNHAGDINQAIEIFTDIVSKRSMKPCLEHYGLMVDLLASAGETEKALRLI 707

Query: 431 DQ 436
++
Sbjct: 708 EE 709



Score = 36.2 bits (82), Expect = 0.092
Identities = 29/106 (27%), Positives = 49/106 (46%), Gaps = 4/106 (3%)
Frame = +2

Query: 170 IAGYIEQARTKEALELFEEMQREGSH--PSLYTIICLLKACSKMGAIDQGKELHSLGVKF 343
++ + KEAL L EM P +Y I L+ C + GK++H+ +K
Sbjct: 42 VSSLCKNGEIKEALSLVTEMDFRNLRIGPEIYGEI--LQGCVYERDLSTGKQIHARILKN 99

Query: 344 R--YECDLYFCNVLIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELI 475
Y + Y L+ YAK LE ++ +F + R+V +W+ +I
Sbjct: 100 GDFYARNEYIETKLVIFYAKCDALEIAEVLFSKLRVRNVFSWAAII 145


>sp|Q3E6Q1|PPR32_ARATH Pentatricopeptide repeat-containing protein
At1g11290 OS=Arabidopsis thaliana GN=PCMP-H40 PE=2 SV=1
Length = 809

Score = 119 bits (297), Expect = 1e-26
Identities = 57/158 (36%), Positives = 94/158 (59%)
Frame = +2

Query: 26 LIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKE 205
L+ K G LDLF + + +MY KC V + +KVF+ M D V+W T++AGY + +
Sbjct: 160 LLVKSGFSLDLFAMTGLENMYAKCRQVNEARKVFDRMPERDLVSWNTIVAGYSQNGMARM 219

Query: 206 ALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIG 385
ALE+ + M E PS TI+ +L A S + I GKE+H ++ ++ + L+
Sbjct: 220 ALEMVKSMCEENLKPSFITIVSVLPAVSALRLISVGKEIHGYAMRSGFDSLVNISTALVD 279

Query: 386 MYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEHED 499
MYAK G+LE ++++FD +R+VV+W+ +I Y ++E+
Sbjct: 280 MYAKCGSLETARQLFDGMLERNVVSWNSMIDAYVQNEN 317



Score = 103 bits (257), Expect = 5e-22
Identities = 45/151 (29%), Positives = 93/151 (61%)
Frame = +2

Query: 41 GLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALELF 220
G D + + + ++DMY KCGS+E +++F+ ML + V+W ++I Y++ KEA+ +F
Sbjct: 266 GFDSLVNISTALVDMYAKCGSLETARQLFDGMLERNVVSWNSMIDAYVQNENPKEAMLIF 325

Query: 221 EEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYAKS 400
++M EG P+ +++ L AC+ +G +++G+ +H L V+ + ++ N LI MY K
Sbjct: 326 QKMLDEGVKPTDVSVMGALHACADLGDLERGRFIHKLSVELGLDRNVSVVNSLISMYCKC 385

Query: 401 GNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
++ + +F + R +V+W+ +I G++++
Sbjct: 386 KEVDTAASMFGKLQSRTLVSWNAMILGFAQN 416



Score = 94.7 bits (234), Expect = 2e-19
Identities = 48/156 (30%), Positives = 90/156 (57%)
Frame = +2

Query: 26 LIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKE 205
L+ K GL + F + ++ ++ + GSV++ +VF + +V + T++ G+ + + +
Sbjct: 59 LVFKNGLYQEHFFQTKLVSLFCRYGSVDEAARVFEPIDSKLNVLYHTMLKGFAKVSDLDK 118

Query: 206 ALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIG 385
AL+ F M+ + P +Y LLK C + GKE+H L VK + DL+ L
Sbjct: 119 ALQFFVRMRYDDVEPVVYNFTYLLKVCGDEAELRVGKEIHGLLVKSGFSLDLFAMTGLEN 178

Query: 386 MYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
MYAK + +++KVFD+ +RD+V+W+ +++GYS++
Sbjct: 179 MYAKCRQVNEARKVFDRMPERDLVSWNTIVAGYSQN 214



Score = 93.2 bits (230), Expect = 6e-19
Identities = 44/164 (26%), Positives = 85/164 (51%)
Frame = +2

Query: 2 EQGAAHDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGY 181
E+G L ++GLD ++ V + ++ MY KC V+ +F + V+W +I G+
Sbjct: 354 ERGRFIHKLSVELGLDRNVSVVNSLISMYCKCKEVDTAASMFGKLQSRTLVSWNAMILGF 413

Query: 182 IEQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDL 361
+ R +AL F +M+ P +T + ++ A +++ K +H + ++ + ++
Sbjct: 414 AQNGRPIDALNYFSQMRSRTVKPDTFTYVSVITAIAELSITHHAKWIHGVVMRSCLDKNV 473

Query: 362 YFCNVLIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
+ L+ MYAK G + ++ +FD S+R V TW+ +I GY H
Sbjct: 474 FVTTALVDMYAKCGAIMIARLIFDMMSERHVTTWNAMIDGYGTH 517



Score = 72.4 bits (176), Expect = 1e-12
Identities = 37/126 (29%), Positives = 66/126 (52%), Gaps = 1/126 (0%)
Frame = +2

Query: 44 LDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALELFE 223
LD ++FV + ++DMY KCG++ + +F+ M W +I GY K ALELFE
Sbjct: 469 LDKNVFVTTALVDMYAKCGAIMIARLIFDMMSERHVTTWNAMIDGYGTHGFGKAALELFE 528

Query: 224 EMQREGSHPSLYTIICLLKACSKMGAIDQG-KELHSLGVKFRYECDLYFCNVLIGMYAKS 400
EMQ+ P+ T + ++ ACS G ++ G K + + + E + ++ + ++
Sbjct: 529 EMQKGTIKPNGVTFLSVISACSHSGLVEAGLKCFYMMKENYSIELSMDHYGAMVDLLGRA 588

Query: 401 GNLEDS 418
G L ++
Sbjct: 589 GRLNEA 594


>sp|Q9ZUT4|PP192_ARATH Pentatricopeptide repeat-containing protein
At2g37320 OS=Arabidopsis thaliana GN=PCMP-E50 PE=2 SV=1
Length = 500

Score = 119 bits (297), Expect = 1e-26
Identities = 57/162 (35%), Positives = 97/162 (59%)
Frame = +2

Query: 8 GAAHDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIE 187
G+ L K G D+++ S ++ +Y G VE+ KVF M + V+W +I+G+ +
Sbjct: 139 GSGFHCLALKGGFISDVYLGSSLVVLYRDSGEVENAYKVFEEMPERNVVSWTAMISGFAQ 198

Query: 188 QARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYF 367
+ R L+L+ +M++ S P+ YT LL AC+ GA+ QG+ +H + + L+
Sbjct: 199 EWRVDICLKLYSKMRKSTSDPNDYTFTALLSACTGSGALGQGRSVHCQTLHMGLKSYLHI 258

Query: 368 CNVLIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
N LI MY K G+L+D+ ++FDQ S +DVV+W+ +I+GY++H
Sbjct: 259 SNSLISMYCKCGDLKDAFRIFDQFSNKDVVSWNSMIAGYAQH 300



Score = 79.7 bits (195), Expect = 7e-15
Identities = 43/167 (25%), Positives = 85/167 (50%), Gaps = 2/167 (1%)
Frame = +2

Query: 5 QGAAHDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYI 184
QG + +GL L + + ++ MY KCG ++D ++F+ D V+W ++IAGY
Sbjct: 239 QGRSVHCQTLHMGLKSYLHISNSLISMYCKCGDLKDAFRIFDQFSNKDVVSWNSMIAGYA 298

Query: 185 EQARTKEALELFE-EMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDL 361
+ +A+ELFE M + G+ P T + +L +C G + +G++ +L + + +L
Sbjct: 299 QHGLAMQAIELFELMMPKSGTKPDAITYLGVLSSCRHAGLVKEGRKFFNLMAEHGLKPEL 358

Query: 362 YFCNVLIGMYAKSGNLEDSQKVFD-QTSKRDVVTWSELISGYSEHED 499
+ L+ + + G L+++ ++ + K + V W L+ H D
Sbjct: 359 NHYSCLVDLLGRFGLLQEALELIENMPMKPNSVIWGSLLFSCRVHGD 405



Score = 56.6 bits (135), Expect = 7e-08
Identities = 42/154 (27%), Positives = 77/154 (50%), Gaps = 15/154 (9%)
Frame = +2

Query: 74 VLDMYM-KCGSVEDGQKVFNNMLR-HDSVAW---GTLIAGYIEQARTKEALE-LFEEMQR 235
VLD+ K G V + Q F + + +W G I+ + +RTK + + EE+
Sbjct: 45 VLDIISSKSGGVSNRQDHFGFVQEFRQTDSWRFRGQAISEDFDLSRTKNGVSSVLEEVML 104

Query: 236 EGSHPSL---------YTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGM 388
E S S+ Y + +++C G H L +K + D+Y + L+ +
Sbjct: 105 EDSSSSVKRDGWSFDAYGLSSAVRSCGLNRDFRTGSGFHCLALKGGFISDVYLGSSLVVL 164

Query: 389 YAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSE 490
Y SG +E++ KVF++ +R+VV+W+ +ISG+++
Sbjct: 165 YRDSGEVENAYKVFEEMPERNVVSWTAMISGFAQ 198


>sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protein
At4g18750, chloroplastic OS=Arabidopsis thaliana
GN=PCMP-H45 PE=2 SV=1
Length = 871

Score = 118 bits (295), Expect = 2e-26
Identities = 50/143 (34%), Positives = 90/143 (62%)
Frame = +2

Query: 65 CSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALELFEEMQREGS 244
C+ +LDMY KCG ++ + VF M V++ ++IAGY + EA++LFEEM+ EG
Sbjct: 334 CNTLLDMYSKCGDLDSAKAVFREMSDRSVVSYTSMIAGYAREGLAGEAVKLFEEMEEEGI 393

Query: 245 HPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYAKSGNLEDSQK 424
P +YT+ +L C++ +D+GK +H + D++ N L+ MYAK G++++++
Sbjct: 394 SPDVYTVTAVLNCCARYRLLDEGKRVHEWIKENDLGFDIFVSNALMDMYAKCGSMQEAEL 453

Query: 425 VFDQTSKRDVVTWSELISGYSEH 493
VF + +D+++W+ +I GYS++
Sbjct: 454 VFSEMRVKDIISWNTIIGGYSKN 476



Score = 118 bits (295), Expect = 2e-26
Identities = 56/151 (37%), Positives = 90/151 (59%), Gaps = 1/151 (0%)
Frame = +2

Query: 44 LDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALELFE 223
L D+FV + ++DMY KCGS+++ + VF+ M D ++W T+I GY + EAL LF
Sbjct: 428 LGFDIFVSNALMDMYAKCGSMQEAELVFSEMRVKDIISWNTIIGGYSKNCYANEALSLFN 487

Query: 224 EMQREGSH-PSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYAKS 400
+ E P T+ C+L AC+ + A D+G+E+H ++ Y D + N L+ MYAK
Sbjct: 488 LLLEEKRFSPDERTVACVLPACASLSAFDKGREIHGYIMRNGYFSDRHVANSLVDMYAKC 547

Query: 401 GNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
G L + +FD + +D+V+W+ +I+GY H
Sbjct: 548 GALLLAHMLFDDIASKDLVSWTVMIAGYGMH 578



Score = 98.2 bits (243), Expect = 2e-20
Identities = 49/153 (32%), Positives = 86/153 (56%)
Frame = +2

Query: 29 IAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEA 208
I K G V + ++ Y+K V+ +KVF+ M D ++W ++I GY+ ++
Sbjct: 221 ILKSGFGERNSVGNSLVAFYLKNQRVDSARKVFDEMTERDVISWNSIINGYVSNGLAEKG 280

Query: 209 LELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGM 388
L +F +M G L TI+ + C+ I G+ +HS+GVK + + FCN L+ M
Sbjct: 281 LSVFVQMLVSGIEIDLATIVSVFAGCADSRLISLGRAVHSIGVKACFSREDRFCNTLLDM 340

Query: 389 YAKSGNLEDSQKVFDQTSKRDVVTWSELISGYS 487
Y+K G+L+ ++ VF + S R VV+++ +I+GY+
Sbjct: 341 YSKCGDLDSAKAVFREMSDRSVVSYTSMIAGYA 373



Score = 79.7 bits (195), Expect = 7e-15
Identities = 42/161 (26%), Positives = 83/161 (51%)
Frame = +2

Query: 2 EQGAAHDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGY 181
+ G D I G +D + S + MY CG +++ +VF+ + ++ W L+
Sbjct: 111 KDGKEVDNFIRGNGFVIDSNLGSKLSLMYTNCGDLKEASRVFDEVKIEKALFWNILMNEL 170

Query: 182 IEQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDL 361
+ ++ LF++M G YT C+ K+ S + ++ G++LH +K +
Sbjct: 171 AKSGDFSGSIGLFKKMMSSGVEMDSYTFSCVSKSFSSLRSVHGGEQLHGFILKSGFGERN 230

Query: 362 YFCNVLIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGY 484
N L+ Y K+ ++ ++KVFD+ ++RDV++W+ +I+GY
Sbjct: 231 SVGNSLVAFYLKNQRVDSARKVFDEMTERDVISWNSIINGY 271



Score = 77.4 bits (189), Expect = 4e-14
Identities = 48/164 (29%), Positives = 81/164 (49%), Gaps = 7/164 (4%)
Frame = +2

Query: 29 IAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEA 208
I + G D V + ++DMY KCG++ +F+++ D V+W +IAGY KEA
Sbjct: 525 IMRNGYFSDRHVANSLVDMYAKCGALLLAHMLFDDIASKDLVSWTVMIAGYGMHGFGKEA 584

Query: 209 LELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDL------YFC 370
+ LF +M++ G + + LL ACS G +D+G ++ R+EC + Y C
Sbjct: 585 IALFNQMRQAGIEADEISFVSLLYACSHSGLVDEGWRFFNI---MRHECKIEPTVEHYAC 641

Query: 371 NVLIGMYAKSGNLEDSQKVFDQTS-KRDVVTWSELISGYSEHED 499
++ M A++G+L + + + D W L+ G H D
Sbjct: 642 --IVDMLARTGDLIKAYRFIENMPIPPDATIWGALLCGCRIHHD 683



Score = 34.7 bits (78), Expect = 0.27
Identities = 18/81 (22%), Positives = 41/81 (50%)
Frame = +2

Query: 260 TIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYAKSGNLEDSQKVFDQT 439
T+ +L+ C+ ++ GKE+ + + D + L MY G+L+++ +VFD+
Sbjct: 96 TLCSVLQLCADSKSLKDGKEVDNFIRGNGFVIDSNLGSKLSLMYTNCGDLKEASRVFDEV 155

Query: 440 SKRDVVTWSELISGYSEHEDY 502
+ W+ L++ ++ D+
Sbjct: 156 KIEKALFWNILMNELAKSGDF 176


>sp|Q9ZUW3|PP172_ARATH Pentatricopeptide repeat-containing protein
At2g27610 OS=Arabidopsis thaliana GN=PCMP-H60 PE=2 SV=1
Length = 868

Score = 117 bits (294), Expect = 2e-26
Identities = 54/156 (34%), Positives = 94/156 (60%), Gaps = 1/156 (0%)
Frame = +2

Query: 29 IAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEA 208
+ K + V + +LD Y+K G VE+ KVF+ + D VAW ++AGY + T+ A
Sbjct: 419 VVKTNYERSSTVGTALLDAYVKLGKVEEAAKVFSGIDDKDIVAWSAMLAGYAQTGETEAA 478

Query: 209 LELFEEMQREGSHPSLYTIICLLKACSKMGA-IDQGKELHSLGVKFRYECDLYFCNVLIG 385
+++F E+ + G P+ +T +L C+ A + QGK+ H +K R + L + L+
Sbjct: 479 IKMFGELTKGGIKPNEFTFSSILNVCAATNASMGQGKQFHGFAIKSRLDSSLCVSSALLT 538

Query: 386 MYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
MYAK GN+E +++VF + ++D+V+W+ +ISGY++H
Sbjct: 539 MYAKKGNIESAEEVFKRQREKDLVSWNSMISGYAQH 574



Score = 107 bits (266), Expect = 4e-23
Identities = 55/151 (36%), Positives = 88/151 (58%)
Frame = +2

Query: 35 KVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALE 214
K G D+ V + ++D YMK + +DG+KVF+ M + V W TLI+GY + E L
Sbjct: 121 KFGFLDDVSVGTSLVDTYMKGSNFKDGRKVFDEMKERNVVTWTTLISGYARNSMNDEVLT 180

Query: 215 LFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYA 394
LF MQ EG+ P+ +T L ++ G +G ++H++ VK + + N LI +Y
Sbjct: 181 LFMRMQNEGTQPNSFTFAAALGVLAEEGVGGRGLQVHTVVVKNGLDKTIPVSNSLINLYL 240

Query: 395 KSGNLEDSQKVFDQTSKRDVVTWSELISGYS 487
K GN+ ++ +FD+T + VVTW+ +ISGY+
Sbjct: 241 KCGNVRKARILFDKTEVKSVVTWNSMISGYA 271



Score = 82.4 bits (202), Expect = 1e-15
Identities = 45/161 (27%), Positives = 86/161 (53%), Gaps = 1/161 (0%)
Frame = +2

Query: 29 IAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNM-LRHDSVAWGTLIAGYIEQARTKE 205
+ K G D + + ++ Y KC ++ D ++F + + V+W +I+G+++ +E
Sbjct: 321 VVKYGFLFDQNIRTALMVAYSKCTAMLDALRLFKEIGCVGNVVSWTAMISGFLQNDGKEE 380

Query: 206 ALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIG 385
A++LF EM+R+G P+ +T +L A + E+H+ VK YE L+
Sbjct: 381 AVDLFSEMKRKGVRPNEFTYSVILTALPVISP----SEVHAQVVKTNYERSSTVGTALLD 436

Query: 386 MYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEHEDYDA 508
Y K G +E++ KVF +D+V WS +++GY++ + +A
Sbjct: 437 AYVKLGKVEEAAKVFSGIDDKDIVAWSAMLAGYAQTGETEA 477



Score = 75.1 bits (183), Expect = 2e-13
Identities = 41/147 (27%), Positives = 78/147 (53%), Gaps = 4/147 (2%)
Frame = +2

Query: 5 QGAAHDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYI 184
QG K LD L V S +L MY K G++E ++VF D V+W ++I+GY
Sbjct: 513 QGKQFHGFAIKSRLDSSLCVSSALLTMYAKKGNIESAEEVFKRQREKDLVSWNSMISGYA 572

Query: 185 EQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDL- 361
+ + +AL++F+EM++ T I + AC+ G +++G++ + V+ +C +
Sbjct: 573 QHGQAMKALDVFKEMKKRKVKMDGVTFIGVFAACTHAGLVEEGEKYFDIMVR---DCKIA 629

Query: 362 ---YFCNVLIGMYAKSGNLEDSQKVFD 433
+ ++ +Y+++G LE + KV +
Sbjct: 630 PTKEHNSCMVDLYSRAGQLEKAMKVIE 656



Score = 70.9 bits (172), Expect = 3e-12
Identities = 40/132 (30%), Positives = 67/132 (50%)
Frame = +2

Query: 110 DGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALELFEEMQREGSHPSLYTIICLLKACS 289
+ +F+ D ++ +L+ G+ RT+EA LF + R G +LK +
Sbjct: 45 NAHNLFDKSPGRDRESYISLLFGFSRDGRTQEAKRLFLNIHRLGMEMDCSIFSSVLKVSA 104

Query: 290 KMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYAKSGNLEDSQKVFDQTSKRDVVTWSE 469
+ G++LH +KF + D+ L+ Y K N +D +KVFD+ +R+VVTW+
Sbjct: 105 TLCDELFGRQLHCQCIKFGFLDDVSVGTSLVDTYMKGSNFKDGRKVFDEMKERNVVTWTT 164

Query: 470 LISGYSEHEDYD 505
LISGY+ + D
Sbjct: 165 LISGYARNSMND 176



Score = 70.1 bits (170), Expect = 6e-12
Identities = 40/158 (25%), Positives = 83/158 (52%), Gaps = 1/158 (0%)
Frame = +2

Query: 26 LIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKE 205
++ K GLD + V + ++++Y+KCG+V + +F+ V W ++I+GY E
Sbjct: 219 VVVKNGLDKTIPVSNSLINLYLKCGNVRKARILFDKTEVKSVVTWNSMISGYAANGLDLE 278

Query: 206 ALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIG 385
AL +F M+ S + ++K C+ + + ++LH VK+ + D L+
Sbjct: 279 ALGMFYSMRLNYVRLSESSFASVIKLCANLKELRFTEQLHCSVVKYGFLFDQNIRTALMV 338

Query: 386 MYAKSGNLEDSQKVFDQTS-KRDVVTWSELISGYSEHE 496
Y+K + D+ ++F + +VV+W+ +ISG+ +++
Sbjct: 339 AYSKCTAMLDALRLFKEIGCVGNVVSWTAMISGFLQND 376


>sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protein
At3g09040, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E88 PE=2 SV=1
Length = 1028

Score = 116 bits (291), Expect = 5e-26
Identities = 60/164 (36%), Positives = 97/164 (59%)
Frame = +2

Query: 2 EQGAAHDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGY 181
E G+ +I K L +LFV + ++DMY KCG++ED +++F M D+V W T+I Y
Sbjct: 445 EMGSQFHSIIIKKKLAKNLFVGNALVDMYAKCGALEDARQIFERMCDRDNVTWNTIIGSY 504

Query: 182 IEQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDL 361
++ EA +LF+ M G + LKAC+ + + QGK++H L VK + DL
Sbjct: 505 VQDENESEAFDLFKRMNLCGIVSDGACLASTLKACTHVHGLYQGKQVHCLSVKCGLDRDL 564

Query: 362 YFCNVLIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
+ + LI MY+K G ++D++KVF + VV+ + LI+GYS++
Sbjct: 565 HTGSSLIDMYSKCGIIKDARKVFSSLPEWSVVSMNALIAGYSQN 608



Score = 107 bits (267), Expect = 3e-23
Identities = 51/155 (32%), Positives = 88/155 (56%)
Frame = +2

Query: 35 KVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALE 214
K+GL +++V S ++ MY KC +E KVF + + V W +I GY + + +E
Sbjct: 355 KLGLASNIYVGSSLVSMYSKCEKMEAAAKVFEALEEKNDVFWNAMIRGYAHNGESHKVME 414

Query: 215 LFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYA 394
LF +M+ G + +T LL C+ ++ G + HS+ +K + +L+ N L+ MYA
Sbjct: 415 LFMDMKSSGYNIDDFTFTSLLSTCAASHDLEMGSQFHSIIIKKKLAKNLFVGNALVDMYA 474

Query: 395 KSGNLEDSQKVFDQTSKRDVVTWSELISGYSEHED 499
K G LED++++F++ RD VTW+ +I Y + E+
Sbjct: 475 KCGALEDARQIFERMCDRDNVTWNTIIGSYVQDEN 509



Score = 97.8 bits (242), Expect = 3e-20
Identities = 56/169 (33%), Positives = 95/169 (56%), Gaps = 2/169 (1%)
Frame = +2

Query: 5 QGAAHDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYI 184
QG L K GLD DL S ++DMY KCG ++D +KVF+++ V+ LIAGY
Sbjct: 547 QGKQVHCLSVKCGLDRDLHTGSSLIDMYSKCGIIKDARKVFSSLPEWSVVSMNALIAGY- 605

Query: 185 EQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLY 364
Q +EA+ LF+EM G +PS T +++AC K ++ G + H K + +
Sbjct: 606 SQNNLEEAVVLFQEMLTRGVNPSEITFATIVEACHKPESLTLGTQFHGQITKRGFSSEGE 665

Query: 365 FCNV-LIGMYAKSGNLEDSQKVFDQ-TSKRDVVTWSELISGYSEHEDYD 505
+ + L+GMY S + ++ +F + +S + +V W+ ++SG+S++ Y+
Sbjct: 666 YLGISLLGMYMNSRGMTEACALFSELSSPKSIVLWTGMMSGHSQNGFYE 714



Score = 89.4 bits (220), Expect = 9e-18
Identities = 44/142 (30%), Positives = 86/142 (60%), Gaps = 2/142 (1%)
Frame = +2

Query: 74 VLDMYMKCGSVEDGQKVFNNMLRHDSVA-WGTLIAGYIEQARTKEALELFEEMQREGSHP 250
+L MYM + + +F+ + S+ W +++G+ + +EAL+ ++EM+ +G P
Sbjct: 671 LLGMYMNSRGMTEACALFSELSSPKSIVLWTGMMSGHSQNGFYEEALKFYKEMRHDGVLP 730

Query: 251 SLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYAKSGNLEDSQKVF 430
T + +L+ CS + ++ +G+ +HSL ++ D N LI MYAK G+++ S +VF
Sbjct: 731 DQATFVTVLRVCSVLSSLREGRAIHSLIFHLAHDLDELTSNTLIDMYAKCGDMKGSSQVF 790

Query: 431 DQTSKR-DVVTWSELISGYSEH 493
D+ +R +VV+W+ LI+GY+++
Sbjct: 791 DEMRRRSNVVSWNSLINGYAKN 812



Score = 80.9 bits (198), Expect = 3e-15
Identities = 46/168 (27%), Positives = 86/168 (51%), Gaps = 3/168 (1%)
Frame = +2

Query: 5 QGAAHDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSV-AWGTLIAGY 181
+G A LI + DLD + ++DMY KCG ++ +VF+ M R +V +W +LI GY
Sbjct: 750 EGRAIHSLIFHLAHDLDELTSNTLIDMYAKCGDMKGSSQVFDEMRRRSNVVSWNSLINGY 809

Query: 182 IEQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGV-KFRYECD 358
+ ++AL++F+ M++ P T + +L ACS G + G+++ + + ++ E
Sbjct: 810 AKNGYAEDALKIFDSMRQSHIMPDEITFLGVLTACSHAGKVSDGRKIFEMMIGQYGIEAR 869

Query: 359 LYFCNVLIGMYAKSGNLEDSQKVFD-QTSKRDVVTWSELISGYSEHED 499
+ ++ + + G L+++ + Q K D WS L+ H D
Sbjct: 870 VDHVACMVDLLGRWGYLQEADDFIEAQNLKPDARLWSSLLGACRIHGD 917



Score = 76.3 bits (186), Expect = 8e-14
Identities = 39/149 (26%), Positives = 76/149 (51%)
Frame = +2

Query: 38 VGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALEL 217
+G+D + + + ++D+Y KC V +K F+ L D AW ++++ Y + + L
Sbjct: 89 LGIDSEGRLGNAIVDLYAKCAQVSYAEKQFD-FLEKDVTAWNSMLSMYSSIGKPGKVLRS 147

Query: 218 FEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYAK 397
F + P+ +T +L C++ ++ G+++H +K E + Y L+ MYAK
Sbjct: 148 FVSLFENQIFPNKFTFSIVLSTCARETNVEFGRQIHCSMIKMGLERNSYCGGALVDMYAK 207

Query: 398 SGNLEDSQKVFDQTSKRDVVTWSELISGY 484
+ D+++VF+ + V W+ L SGY
Sbjct: 208 CDRISDARRVFEWIVDPNTVCWTCLFSGY 236



Score = 75.1 bits (183), Expect = 2e-13
Identities = 37/140 (26%), Positives = 76/140 (54%)
Frame = +2

Query: 74 VLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALELFEEMQREGSHPS 253
V++ Y++ G ++D + +F M D VAW +I+G+ ++ A+E F M++ +
Sbjct: 267 VINTYIRLGKLKDARLLFGEMSSPDVVAWNVMISGHGKRGCETVAIEYFFNMRKSSVKST 326

Query: 254 LYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYAKSGNLEDSQKVFD 433
T+ +L A + +D G +H+ +K ++Y + L+ MY+K +E + KVF+
Sbjct: 327 RSTLGSVLSAIGIVANLDLGLVVHAEAIKLGLASNIYVGSSLVSMYSKCEKMEAAAKVFE 386

Query: 434 QTSKRDVVTWSELISGYSEH 493
+++ V W+ +I GY+ +
Sbjct: 387 ALEEKNDVFWNAMIRGYAHN 406



Score = 68.2 bits (165), Expect = 2e-11
Identities = 38/152 (25%), Positives = 70/152 (46%)
Frame = +2

Query: 35 KVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALE 214
K+GL+ + + ++DMY KC + D ++VF ++ ++V W L +GY++ +EA+
Sbjct: 188 KMGLERNSYCGGALVDMYAKCDRISDARRVFEWIVDPNTVCWTCLFSGYVKAGLPEEAVL 247

Query: 215 LFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYA 394
+FE M+ EG P + +I Y
Sbjct: 248 VFERMRDEGHRPDHLAFV-----------------------------------TVINTYI 272

Query: 395 KSGNLEDSQKVFDQTSKRDVVTWSELISGYSE 490
+ G L+D++ +F + S DVV W+ +ISG+ +
Sbjct: 273 RLGKLKDARLLFGEMSSPDVVAWNVMISGHGK 304



Score = 35.8 bits (81), Expect = 0.12
Identities = 19/63 (30%), Positives = 33/63 (52%)
Frame = +2

Query: 299 AIDQGKELHSLGVKFRYECDLYFCNVLIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELIS 478
A+ GK +HS + + + N ++ +YAK + ++K FD K DV W+ ++S
Sbjct: 75 ALRIGKAVHSKSLILGIDSEGRLGNAIVDLYAKCAQVSYAEKQFDFLEK-DVTAWNSMLS 133

Query: 479 GYS 487
YS
Sbjct: 134 MYS 136


>sp|O64705|PP184_ARATH Pentatricopeptide repeat-containing protein
At2g34400 OS=Arabidopsis thaliana GN=PCMP-E23 PE=2 SV=2
Length = 621

Score = 116 bits (291), Expect = 5e-26
Identities = 53/153 (34%), Positives = 95/153 (62%)
Frame = +2

Query: 35 KVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALE 214
KVGL+ D+ + ++ MY KCG V +K+F+ + D+V+W ++I+GY E K+A++
Sbjct: 160 KVGLERDVHINHSLIMMYAKCGQVGYARKLFDEITERDTVSWNSMISGYSEAGYAKDAMD 219

Query: 215 LFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYA 394
LF +M+ EG P T++ +L ACS +G + G+ L + + + + + LI MY
Sbjct: 220 LFRKMEEEGFEPDERTLVSMLGACSHLGDLRTGRLLEEMAITKKIGLSTFLGSKLISMYG 279

Query: 395 KSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
K G+L+ +++VF+Q K+D V W+ +I+ YS++
Sbjct: 280 KCGDLDSARRVFNQMIKKDRVAWTAMITVYSQN 312



Score = 107 bits (268), Expect = 2e-23
Identities = 47/148 (31%), Positives = 88/148 (59%)
Frame = +2

Query: 44 LDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALELFE 223
+ L F+ S ++ MY KCG ++ ++VFN M++ D VAW +I Y + ++ EA +LF
Sbjct: 264 IGLSTFLGSKLISMYGKCGDLDSARRVFNQMIKKDRVAWTAMITVYSQNGKSSEAFKLFF 323

Query: 224 EMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYAKSG 403
EM++ G P T+ +L AC +GA++ GK++ + + + ++Y L+ MY K G
Sbjct: 324 EMEKTGVSPDAGTLSTVLSACGSVGALELGKQIETHASELSLQHNIYVATGLVDMYGKCG 383

Query: 404 NLEDSQKVFDQTSKRDVVTWSELISGYS 487
+E++ +VF+ ++ TW+ +I+ Y+
Sbjct: 384 RVEEALRVFEAMPVKNEATWNAMITAYA 411



Score = 73.2 bits (178), Expect = 7e-13
Identities = 43/122 (35%), Positives = 66/122 (54%)
Frame = +2

Query: 125 FNNMLRHDSVAWGTLIAGYIEQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAI 304
FN M+R + W A AL L+ M+ G P +T + AC+K+ I
Sbjct: 99 FNYMIRGLTNTWNDHEA----------ALSLYRRMKFSGLKPDKFTYNFVFIACAKLEEI 148

Query: 305 DQGKELHSLGVKFRYECDLYFCNVLIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGY 484
G+ +HS K E D++ + LI MYAK G + ++K+FD+ ++RD V+W+ +ISGY
Sbjct: 149 GVGRSVHSSLFKVGLERDVHINHSLIMMYAKCGQVGYARKLFDEITERDTVSWNSMISGY 208

Query: 485 SE 490
SE
Sbjct: 209 SE 210



Score = 68.2 bits (165), Expect = 2e-11
Identities = 44/168 (26%), Positives = 81/168 (48%), Gaps = 2/168 (1%)
Frame = +2

Query: 2 EQGAAHDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGY 181
E G + +++ L +++V + ++DMY KCG VE+ +VF M + W +I Y
Sbjct: 351 ELGKQIETHASELSLQHNIYVATGLVDMYGKCGRVEEALRVFEAMPVKNEATWNAMITAY 410

Query: 182 IEQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQG-KELHSLGVKFRYECD 358
Q KEAL LF+ M PS T I +L AC G + QG + H + F
Sbjct: 411 AHQGHAKEALLLFDRM---SVPPSDITFIGVLSACVHAGLVHQGCRYFHEMSSMFGLVPK 467

Query: 359 LYFCNVLIGMYAKSGNLEDSQKVFDQ-TSKRDVVTWSELISGYSEHED 499
+ +I + +++G L+++ + ++ K D + + ++ + +D
Sbjct: 468 IEHYTNIIDLLSRAGMLDEAWEFMERFPGKPDEIMLAAILGACHKRKD 515


tr_hit_id Q5W964
Definition tr|Q5W964|Q5W964_PHYPA PPR986-12 OS=Physcomitrella patens
Align length 160
Score (bit) 132.0
E-value 1.0e-29
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916568|Adiantum capillus-veneris mRNA, clone:
YMU001_000089_B04.
(508 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q5W964|Q5W964_PHYPA PPR986-12 OS=Physcomitrella patens PE=2 SV=1 132 1e-29
tr|A9TNX6|A9TNX6_PHYPA Predicted protein OS=Physcomitrella paten... 132 1e-29
tr|A7PEB0|A7PEB0_VITVI Chromosome chr11 scaffold_13, whole genom... 131 2e-29
tr|A9U2Q7|A9U2Q7_PHYPA Predicted protein OS=Physcomitrella paten... 130 5e-29
tr|B8LQA8|B8LQA8_PICSI Putative uncharacterized protein OS=Picea... 129 6e-29
tr|B8LKN6|B8LKN6_PICSI Putative uncharacterized protein OS=Picea... 129 1e-28
tr|A9RSU9|A9RSU9_PHYPA Predicted protein OS=Physcomitrella paten... 127 4e-28
tr|A7PPB6|A7PPB6_VITVI Chromosome chr8 scaffold_23, whole genome... 126 5e-28
tr|A5C1S9|A5C1S9_VITVI Putative uncharacterized protein OS=Vitis... 126 5e-28
tr|Q7XHP5|Q7XHP5_ORYSJ Os07g0239600 protein OS=Oryza sativa subs... 125 1e-27
tr|A3BI45|A3BI45_ORYSJ Putative uncharacterized protein OS=Oryza... 125 1e-27
tr|A7QI67|A7QI67_VITVI Chromosome chr17 scaffold_101, whole geno... 125 2e-27
tr|A7NVQ9|A7NVQ9_VITVI Chromosome chr18 scaffold_1, whole genome... 125 2e-27
tr|A5AJZ0|A5AJZ0_VITVI Putative uncharacterized protein OS=Vitis... 125 2e-27
tr|A5C5E6|A5C5E6_VITVI Putative uncharacterized protein OS=Vitis... 124 2e-27
tr|Q5W963|Q5W963_PHYPA PPR1106-17 OS=Physcomitrella patens PE=2 ... 124 3e-27
tr|A5BWB7|A5BWB7_VITVI Putative uncharacterized protein OS=Vitis... 124 3e-27
tr|A7PUR6|A7PUR6_VITVI Chromosome chr4 scaffold_32, whole genome... 124 3e-27
tr|A9TDA2|A9TDA2_PHYPA Predicted protein OS=Physcomitrella paten... 123 4e-27
tr|A9T480|A9T480_PHYPA Predicted protein (Fragment) OS=Physcomit... 123 4e-27
tr|B8BMF2|B8BMF2_ORYSI Putative uncharacterized protein OS=Oryza... 123 6e-27
tr|A7QWN9|A7QWN9_VITVI Chromosome chr4 scaffold_205, whole genom... 123 6e-27
tr|A7PSG6|A7PSG6_VITVI Chromosome chr6 scaffold_28, whole genome... 122 8e-27
tr|A5BKU6|A5BKU6_VITVI Putative uncharacterized protein OS=Vitis... 122 8e-27
tr|A7QW05|A7QW05_VITVI Chromosome chr2 scaffold_196, whole genom... 122 1e-26
tr|A7QUQ9|A7QUQ9_VITVI Chromosome chr1 scaffold_180, whole genom... 122 1e-26
tr|Q94E87|Q94E87_ORYSJ PPR-repeat protein-like (Putative unchara... 122 1e-26
tr|Q2QNV4|Q2QNV4_ORYSJ Pentatricopeptide, putative, expressed OS... 122 1e-26
tr|Q0IMR5|Q0IMR5_ORYSJ Os12g0552300 protein OS=Oryza sativa subs... 122 1e-26
tr|A9U4W7|A9U4W7_PHYPA Predicted protein OS=Physcomitrella paten... 122 1e-26

>tr|Q5W964|Q5W964_PHYPA PPR986-12 OS=Physcomitrella patens PE=2 SV=1
Length = 986

Score = 132 bits (332), Expect = 1e-29
Identities = 59/160 (36%), Positives = 100/160 (62%)
Frame = +2

Query: 26 LIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKE 205
LI K G D DLFV + +++M++KCG + D KVF+N+ D V W ++I G R K+
Sbjct: 236 LILKAGWDTDLFVGTALINMHIKCGDIGDATKVFDNLPTRDLVTWTSMITGLARHGRFKQ 295

Query: 206 ALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIG 385
A LF+ M+ EG P + LL+AC+ A++QGK++H+ + ++ ++Y ++
Sbjct: 296 ACNLFQRMEEEGVQPDKVAFVSLLRACNHPEALEQGKKVHARMKEVGWDTEIYVGTAILS 355

Query: 386 MYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEHEDYD 505
MY K G++ED+ +VFD R+VV+W+ +I+G+++H D
Sbjct: 356 MYTKCGSMEDALEVFDLVKGRNVVSWTAMIAGFAQHGRID 395



Score = 129 bits (323), Expect = 1e-28
Identities = 58/164 (35%), Positives = 100/164 (60%)
Frame = +2

Query: 2 EQGAAHDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGY 181
E G LI K GL+ DL V + ++ M++ CG + + +FN+M + D V+W T+IAG+
Sbjct: 531 ELGKWVHFLIMKAGLESDLHVSNALVSMFVNCGDLMSAKNLFNDMPKRDLVSWNTIIAGF 590

Query: 182 IEQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDL 361
++ + + A + F+ MQ G P T LL AC+ A+ +G+ LH+L + ++CD+
Sbjct: 591 VQHGKNQVAFDYFKMMQESGIKPDKITFTGLLNACASPEALTEGRRLHALITEAAFDCDV 650

Query: 362 YFCNVLIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
LI MY K G++ED+ +VF + K++V +W+ +I+GY++H
Sbjct: 651 LVGTGLISMYTKCGSIEDAHQVFHKLPKKNVYSWTSMIAGYAQH 694



Score = 124 bits (310), Expect = 3e-27
Identities = 60/168 (35%), Positives = 100/168 (59%)
Frame = +2

Query: 2 EQGAAHDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGY 181
EQG + +VG D +++V + +L MY KCGS+ED +VF+ + + V+W +IAG+
Sbjct: 329 EQGKKVHARMKEVGWDTEIYVGTAILSMYTKCGSMEDALEVFDLVKGRNVVSWTAMIAGF 388

Query: 182 IEQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDL 361
+ R EA F +M G P+ T + +L ACS A+ +G+++ ++ Y D
Sbjct: 389 AQHGRIDEAFLFFNKMIESGIEPNRVTFMSILGACSSPSALKRGQQIQDHIIEAGYGSDD 448

Query: 362 YFCNVLIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEHEDYD 505
L+ MYAK G+L+D+ +VF++ SK++VV W+ +I+ Y +HE YD
Sbjct: 449 RVRTALLSMYAKCGSLKDAHRVFEKISKQNVVAWNAMITAYVQHEQYD 496



Score = 119 bits (299), Expect = 6e-26
Identities = 53/155 (34%), Positives = 96/155 (61%)
Frame = +2

Query: 29 IAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEA 208
I K G+ D+F+ + +++MY KCG+ +++F++M D +W L+ GY++ +EA
Sbjct: 136 IKKSGVQPDIFMRNTLINMYAKCGNTISAKQIFDDMREKDVYSWNLLLGGYVQHGLYEEA 195

Query: 209 LELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGM 388
+L E+M ++ P T + +L AC+ +D+G+EL++L +K ++ DL+ LI M
Sbjct: 196 FKLHEQMVQDSVKPDKRTFVSMLNACADARNVDKGRELYNLILKAGWDTDLFVGTALINM 255

Query: 389 YAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
+ K G++ D+ KVFD RD+VTW+ +I+G + H
Sbjct: 256 HIKCGDIGDATKVFDNLPTRDLVTWTSMITGLARH 290



Score = 108 bits (270), Expect = 1e-22
Identities = 50/155 (32%), Positives = 88/155 (56%)
Frame = +2

Query: 29 IAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEA 208
I + G D V + +L MY KCGS++D +VF + + + VAW +I Y++ + A
Sbjct: 439 IIEAGYGSDDRVRTALLSMYAKCGSLKDAHRVFEKISKQNVVAWNAMITAYVQHEQYDNA 498

Query: 209 LELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGM 388
L F+ + +EG P+ T +L C +++ GK +H L +K E DL+ N L+ M
Sbjct: 499 LATFQALLKEGIKPNSSTFTSILNVCKSSDSLELGKWVHFLIMKAGLESDLHVSNALVSM 558

Query: 389 YAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
+ G+L ++ +F+ KRD+V+W+ +I+G+ +H
Sbjct: 559 FVNCGDLMSAKNLFNDMPKRDLVSWNTIIAGFVQH 593



Score = 94.0 bits (232), Expect = 4e-18
Identities = 49/164 (29%), Positives = 85/164 (51%), Gaps = 1/164 (0%)
Frame = +2

Query: 5 QGAAHDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYI 184
+G LI + D D+ V + ++ MY KCGS+ED +VF+ + + + +W ++IAGY
Sbjct: 633 EGRRLHALITEAAFDCDVLVGTGLISMYTKCGSIEDAHQVFHKLPKKNVYSWTSMIAGYA 692

Query: 185 EQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLY 364
+ R KEALELF +MQ+EG P T + L AC+ G I++G +F E +
Sbjct: 693 QHGRGKEALELFYQMQQEGVKPDWITFVGALSACAHAGLIEEGLHHFQSMKEFNIEPRME 752

Query: 365 FCNVLIGMYAKSGNLEDS-QKVFDQTSKRDVVTWSELISGYSEH 493
++ ++ ++G L ++ + + + D W L+ H
Sbjct: 753 HYGCMVDLFGRAGLLNEAVEFIIKMQVEPDSRVWGALLGACQVH 796



Score = 63.5 bits (153), Expect = 6e-09
Identities = 33/103 (32%), Positives = 59/103 (57%), Gaps = 2/103 (1%)
Frame = +2

Query: 203 EALELFEEMQREGSHPSLY--TIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNV 376
EA+++ E + + SH +Y T LL+ C K + G+ +++ K + D++ N
Sbjct: 93 EAMQVLERV--DSSHIQIYRQTYSALLQLCIKFKNLGDGERIYNHIKKSGVQPDIFMRNT 150

Query: 377 LIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEHEDYD 505
LI MYAK GN ++++FD ++DV +W+ L+ GY +H Y+
Sbjct: 151 LINMYAKCGNTISAKQIFDDMREKDVYSWNLLLGGYVQHGLYE 193


>tr|A9TNX6|A9TNX6_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_224041 PE=4 SV=1
Length = 986

Score = 132 bits (332), Expect = 1e-29
Identities = 59/160 (36%), Positives = 100/160 (62%)
Frame = +2

Query: 26 LIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKE 205
LI K G D DLFV + +++M++KCG + D KVF+N+ D V W ++I G R K+
Sbjct: 236 LILKAGWDTDLFVGTALINMHIKCGDIGDATKVFDNLPTRDLVTWTSMITGLARHGRFKQ 295

Query: 206 ALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIG 385
A LF+ M+ EG P + LL+AC+ A++QGK++H+ + ++ ++Y ++
Sbjct: 296 ACNLFQRMEEEGVQPDKVAFVSLLRACNHPEALEQGKKVHARMKEVGWDTEIYVGTAILS 355

Query: 386 MYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEHEDYD 505
MY K G++ED+ +VFD R+VV+W+ +I+G+++H D
Sbjct: 356 MYTKCGSMEDALEVFDLVKGRNVVSWTAMIAGFAQHGRID 395



Score = 129 bits (323), Expect = 1e-28
Identities = 58/164 (35%), Positives = 100/164 (60%)
Frame = +2

Query: 2 EQGAAHDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGY 181
E G LI K GL+ DL V + ++ M++ CG + + +FN+M + D V+W T+IAG+
Sbjct: 531 ELGKWVHFLIMKAGLESDLHVSNALVSMFVNCGDLMSAKNLFNDMPKRDLVSWNTIIAGF 590

Query: 182 IEQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDL 361
++ + + A + F+ MQ G P T LL AC+ A+ +G+ LH+L + ++CD+
Sbjct: 591 VQHGKNQVAFDYFKMMQESGIKPDKITFTGLLNACASPEALTEGRRLHALITEAAFDCDV 650

Query: 362 YFCNVLIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
LI MY K G++ED+ +VF + K++V +W+ +I+GY++H
Sbjct: 651 LVGTGLISMYTKCGSIEDAHQVFHKLPKKNVYSWTSMITGYAQH 694



Score = 124 bits (310), Expect = 3e-27
Identities = 60/168 (35%), Positives = 100/168 (59%)
Frame = +2

Query: 2 EQGAAHDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGY 181
EQG + +VG D +++V + +L MY KCGS+ED +VF+ + + V+W +IAG+
Sbjct: 329 EQGKKVHARMKEVGWDTEIYVGTAILSMYTKCGSMEDALEVFDLVKGRNVVSWTAMIAGF 388

Query: 182 IEQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDL 361
+ R EA F +M G P+ T + +L ACS A+ +G+++ ++ Y D
Sbjct: 389 AQHGRIDEAFLFFNKMIESGIEPNRVTFMSILGACSSPSALKRGQQIQDHIIEAGYGSDD 448

Query: 362 YFCNVLIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEHEDYD 505
L+ MYAK G+L+D+ +VF++ SK++VV W+ +I+ Y +HE YD
Sbjct: 449 RVRTALLSMYAKCGSLKDAHRVFEKISKQNVVAWNAMITAYVQHEQYD 496



Score = 120 bits (300), Expect = 5e-26
Identities = 53/155 (34%), Positives = 96/155 (61%)
Frame = +2

Query: 29 IAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEA 208
I K G+ D+F+ + +++MY KCG+ +++F++M D +W L+ GY++ +EA
Sbjct: 136 IKKSGVQPDIFMWNTLINMYAKCGNTISAKQIFDDMREKDVYSWNLLLGGYVQHGLYEEA 195

Query: 209 LELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGM 388
+L E+M ++ P T + +L AC+ +D+G+EL++L +K ++ DL+ LI M
Sbjct: 196 FKLHEQMVQDSVKPDKRTFVSMLNACADARNVDKGRELYNLILKAGWDTDLFVGTALINM 255

Query: 389 YAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
+ K G++ D+ KVFD RD+VTW+ +I+G + H
Sbjct: 256 HIKCGDIGDATKVFDNLPTRDLVTWTSMITGLARH 290



Score = 108 bits (270), Expect = 1e-22
Identities = 50/155 (32%), Positives = 88/155 (56%)
Frame = +2

Query: 29 IAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEA 208
I + G D V + +L MY KCGS++D +VF + + + VAW +I Y++ + A
Sbjct: 439 IIEAGYGSDDRVRTALLSMYAKCGSLKDAHRVFEKISKQNVVAWNAMITAYVQHEQYDNA 498

Query: 209 LELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGM 388
L F+ + +EG P+ T +L C +++ GK +H L +K E DL+ N L+ M
Sbjct: 499 LATFQALLKEGIKPNSSTFTSILNVCKSSDSLELGKWVHFLIMKAGLESDLHVSNALVSM 558

Query: 389 YAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
+ G+L ++ +F+ KRD+V+W+ +I+G+ +H
Sbjct: 559 FVNCGDLMSAKNLFNDMPKRDLVSWNTIIAGFVQH 593



Score = 92.4 bits (228), Expect = 1e-17
Identities = 48/164 (29%), Positives = 84/164 (51%), Gaps = 1/164 (0%)
Frame = +2

Query: 5 QGAAHDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYI 184
+G LI + D D+ V + ++ MY KCGS+ED +VF+ + + + +W ++I GY
Sbjct: 633 EGRRLHALITEAAFDCDVLVGTGLISMYTKCGSIEDAHQVFHKLPKKNVYSWTSMITGYA 692

Query: 185 EQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLY 364
+ R KEALELF +MQ+EG P T + L AC+ G I++G +F E +
Sbjct: 693 QHGRGKEALELFYQMQQEGVKPDWITFVGALSACAHAGLIEEGLHHFQSMKEFNIEPRME 752

Query: 365 FCNVLIGMYAKSGNLEDS-QKVFDQTSKRDVVTWSELISGYSEH 493
++ ++ ++G L ++ + + + D W L+ H
Sbjct: 753 HYGCMVDLFGRAGLLNEAVEFIIKMQVEPDSRVWGALLGACQVH 796



Score = 63.9 bits (154), Expect = 4e-09
Identities = 33/103 (32%), Positives = 59/103 (57%), Gaps = 2/103 (1%)
Frame = +2

Query: 203 EALELFEEMQREGSHPSLY--TIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNV 376
EA+++ E + + SH +Y T LL+ C K + G+ +++ K + D++ N
Sbjct: 93 EAMQVLERV--DSSHIQIYRQTYSALLQLCIKFKNLGDGERIYNHIKKSGVQPDIFMWNT 150

Query: 377 LIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEHEDYD 505
LI MYAK GN ++++FD ++DV +W+ L+ GY +H Y+
Sbjct: 151 LINMYAKCGNTISAKQIFDDMREKDVYSWNLLLGGYVQHGLYE 193


>tr|A7PEB0|A7PEB0_VITVI Chromosome chr11 scaffold_13, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00016595001
PE=4 SV=1
Length = 1005

Score = 131 bits (330), Expect = 2e-29
Identities = 59/155 (38%), Positives = 99/155 (63%)
Frame = +2

Query: 29 IAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEA 208
I K LD + FV + ++DMY K +ED + +FN +++ D AW ++AGY + + ++A
Sbjct: 558 IVKNSLDGNDFVGTALVDMYAKNRFLEDAETIFNRLIKRDLFAWTVIVAGYAQDGQGEKA 617

Query: 209 LELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGM 388
++ F +MQREG P+ +T+ L CS++ +D G++LHS+ +K D++ + L+ M
Sbjct: 618 VKCFIQMQREGVKPNEFTLASSLSGCSRIATLDSGRQLHSMAIKAGQSGDMFVASALVDM 677

Query: 389 YAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
YAK G +ED++ VFD RD V+W+ +I GYS+H
Sbjct: 678 YAKCGCVEDAEVVFDGLVSRDTVSWNTIICGYSQH 712



Score = 121 bits (304), Expect = 2e-26
Identities = 53/154 (34%), Positives = 96/154 (62%)
Frame = +2

Query: 29 IAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEA 208
+ K G + D VC+ ++ MYMK GSV+DG +VF D ++W L++G+ +
Sbjct: 457 VCKYGFEYDNTVCNALVTMYMKIGSVQDGCRVFEATTNRDLISWNALLSGFHDNETCDTG 516

Query: 209 LELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGM 388
L +F +M EG +P++YT I +L++CS + +D GK++H+ VK + + + L+ M
Sbjct: 517 LRIFNQMLAEGFNPNMYTFISILRSCSSLSDVDLGKQVHAQIVKNSLDGNDFVGTALVDM 576

Query: 389 YAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSE 490
YAK+ LED++ +F++ KRD+ W+ +++GY++
Sbjct: 577 YAKNRFLEDAETIFNRLIKRDLFAWTVIVAGYAQ 610



Score = 120 bits (300), Expect = 5e-26
Identities = 54/160 (33%), Positives = 98/160 (61%)
Frame = +2

Query: 26 LIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKE 205
L ++G +LD F+ ++DMY KCG D KVF + D V+W +I ++ +++E
Sbjct: 355 LAIRIGCELDEFISCCLVDMYSKCGLAGDALKVFVRIEDPDVVSWSAIITCLDQKGQSRE 414

Query: 206 ALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIG 385
A E+F+ M+ G P+ +T+ L+ A + +G + G+ +H+ K+ +E D CN L+
Sbjct: 415 AAEVFKRMRHSGVIPNQFTLASLVSAATDLGDLYYGESIHACVCKYGFEYDNTVCNALVT 474

Query: 386 MYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEHEDYD 505
MY K G+++D +VF+ T+ RD+++W+ L+SG+ ++E D
Sbjct: 475 MYMKIGSVQDGCRVFEATTNRDLISWNALLSGFHDNETCD 514



Score = 99.4 bits (246), Expect = 9e-20
Identities = 52/165 (31%), Positives = 94/165 (56%)
Frame = +2

Query: 5 QGAAHDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYI 184
+G A + K G++ D + + ++++Y KCGS KVF + D V+W LI G++
Sbjct: 146 EGKAIHGQVIKSGINPDSHLWNSLVNVYAKCGSANYACKVFGEIPERDVVSWTALITGFV 205

Query: 185 EQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLY 364
+ A+ LF EM+REG + +T LKACS ++ GK++H+ +K DL+
Sbjct: 206 AEGYGSGAVNLFCEMRREGVEANEFTYATALKACSMCLDLEFGKQVHAEAIKVGDFSDLF 265

Query: 365 FCNVLIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEHED 499
+ L+ +YAK G + +++VF K++ V+W+ L++G+++ D
Sbjct: 266 VGSALVDLYAKCGEMVLAERVFLCMPKQNAVSWNALLNGFAQMGD 310



Score = 95.9 bits (237), Expect = 1e-18
Identities = 51/148 (34%), Positives = 84/148 (56%)
Frame = +2

Query: 35 KVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALE 214
KVG DLFV S ++D+Y KCG + ++VF M + ++V+W L+ G+ + ++ L
Sbjct: 257 KVGDFSDLFVGSALVDLYAKCGEMVLAERVFLCMPKQNAVSWNALLNGFAQMGDAEKVLN 316

Query: 215 LFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYA 394
LF M + S +T+ +LK C+ G + G+ +HSL ++ E D + L+ MY+
Sbjct: 317 LFCRMTGSEINFSKFTLSTVLKGCANSGNLRAGQIVHSLAIRIGCELDEFISCCLVDMYS 376

Query: 395 KSGNLEDSQKVFDQTSKRDVVTWSELIS 478
K G D+ KVF + DVV+WS +I+
Sbjct: 377 KCGLAGDALKVFVRIEDPDVVSWSAIIT 404



Score = 93.6 bits (231), Expect = 5e-18
Identities = 49/155 (31%), Positives = 84/155 (54%), Gaps = 2/155 (1%)
Frame = +2

Query: 35 KVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALE 214
K G D+FV S ++DMY KCG VED + VF+ ++ D+V+W T+I GY + + +AL+
Sbjct: 661 KAGQSGDMFVASALVDMYAKCGCVEDAEVVFDGLVSRDTVSWNTIICGYSQHGQGGKALK 720

Query: 215 LFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKE-LHSLGVKFRYECDLYFCNVLIGMY 391
FE M EG+ P T I +L ACS MG I++GK+ +SL + + ++ +
Sbjct: 721 AFEAMLDEGTVPDEVTFIGVLSACSHMGLIEEGKKHFNSLSKIYGITPTIEHYACMVDIL 780

Query: 392 AKSGNLEDSQKVFDQTS-KRDVVTWSELISGYSEH 493
++G + + ++ +V+ W ++ H
Sbjct: 781 GRAGKFHEVESFIEEMKLTSNVLIWETVLGACKMH 815



Score = 57.4 bits (137), Expect = 4e-07
Identities = 25/71 (35%), Positives = 44/71 (61%)
Frame = +2

Query: 272 LLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYAKSGNLEDSQKVFDQTSKRD 451
+L+ C+ G +++GK +H +K D + N L+ +YAK G+ + KVF + +RD
Sbjct: 134 MLRTCASKGDLNEGKAIHGQVIKSGINPDSHLWNSLVNVYAKCGSANYACKVFGEIPERD 193

Query: 452 VVTWSELISGY 484
VV+W+ LI+G+
Sbjct: 194 VVSWTALITGF 204


>tr|A9U2Q7|A9U2Q7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_154890 PE=4 SV=1
Length = 922

Score = 130 bits (326), Expect = 5e-29
Identities = 61/149 (40%), Positives = 97/149 (65%)
Frame = +2

Query: 53 DLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALELFEEMQ 232
D+++ ++++ MY KCGS+ED VF +M D V+W +I+GY R +EA++LF +MQ
Sbjct: 85 DIYLNNMLISMYSKCGSIEDANNVFQSMEDKDVVSWNAMISGYALHGRGQEAVDLFYQMQ 144

Query: 233 REGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYAKSGNLE 412
REG P+ + I +L AC ++ G+++HS K YE D+ LI MY K G+LE
Sbjct: 145 REGLKPNQNSFISILSACQTPIVLEFGEQIHSHITKAGYESDVNVSTALINMYCKCGSLE 204

Query: 413 DSQKVFDQTSKRDVVTWSELISGYSEHED 499
++KVF++ +R+VV+W+ +ISGY +H D
Sbjct: 205 LARKVFNEMRERNVVSWTAMISGYVQHGD 233



Score = 120 bits (300), Expect = 5e-26
Identities = 60/164 (36%), Positives = 100/164 (60%)
Frame = +2

Query: 2 EQGAAHDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGY 181
EQG I + GL+ ++ V + ++ MY +CGS+ + ++VF+N+ + V+W +IAGY
Sbjct: 270 EQGLKLHAYIKQAGLEQEVLVGNALISMYARCGSLANARQVFDNLRSPNRVSWNAMIAGY 329

Query: 182 IEQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDL 361
E +EA LF +MQ++G P +T LL C+ +++GKELHS V+ +E D+
Sbjct: 330 GE-GFMEEAFRLFRDMQQKGFQPDRFTYASLLAICADRADLNRGKELHSQIVRTAWEADV 388

Query: 362 YFCNVLIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
LI MYAK G+LE+++KVF+Q +++ V+W+ I+ H
Sbjct: 389 TVATALISMYAKCGSLEEARKVFNQMPEKNAVSWNAFIACCCRH 432



Score = 116 bits (290), Expect = 7e-25
Identities = 55/154 (35%), Positives = 96/154 (62%)
Frame = +2

Query: 29 IAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEA 208
I K G + D+ V + +++MY KCGS+E +KVFN M + V+W +I+GY++ +KEA
Sbjct: 178 ITKAGYESDVNVSTALINMYCKCGSLELARKVFNEMRERNVVSWTAMISGYVQHGDSKEA 237

Query: 209 LELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGM 388
LF+++ R G+ P+ + +L AC+ ++QG +LH+ + E ++ N LI M
Sbjct: 238 FVLFQKLIRSGTQPNKVSFASILGACTNPNDLEQGLKLHAYIKQAGLEQEVLVGNALISM 297

Query: 389 YAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSE 490
YA+ G+L ++++VFD + V+W+ +I+GY E
Sbjct: 298 YARCGSLANARQVFDNLRSPNRVSWNAMIAGYGE 331



Score = 102 bits (255), Expect = 8e-21
Identities = 49/155 (31%), Positives = 88/155 (56%)
Frame = +2

Query: 29 IAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEA 208
I + + D+ V + ++ MY KCGS+E+ +KVFN M ++V+W IA KEA
Sbjct: 379 IVRTAWEADVTVATALISMYAKCGSLEEARKVFNQMPEKNAVSWNAFIACCCRHGSEKEA 438

Query: 209 LELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGM 388
++F++M+R+ P T I LL +C+ ++G+ +H ++ + N LI M
Sbjct: 439 FQVFKQMRRDDVIPDHVTFITLLNSCTSPEDFERGRYIHGKIDQWGMLSNNLVANALISM 498

Query: 389 YAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
Y + G L D+++VF + +RD+ +W+ +I+ Y +H
Sbjct: 499 YGRCGKLADAREVFYRIRRRDLGSWNAMIAAYVQH 533



Score = 101 bits (251), Expect = 2e-20
Identities = 48/147 (32%), Positives = 83/147 (56%)
Frame = +2

Query: 62 VCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALELFEEMQREG 241
V + ++ MY +CG + D ++VF + R D +W +IA Y++ A +LF + + EG
Sbjct: 491 VANALISMYGRCGKLADAREVFYRIRRRDLGSWNAMIAAYVQHGANGSAFDLFIKYKSEG 550

Query: 242 SHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYAKSGNLEDSQ 421
YT I +L+A + + +D G+++H L K E D+ LI MY+K G+L D+
Sbjct: 551 GKGDKYTFINVLRAIANLEDLDAGRKIHGLVEKAGLEKDIRILTTLIKMYSKCGSLRDAY 610

Query: 422 KVFDQTSKRDVVTWSELISGYSEHEDY 502
VF ++DVV W+ +++ Y+ H D+
Sbjct: 611 SVFKNVQEKDVVCWNAMLAAYN-HSDH 636



Score = 97.4 bits (241), Expect = 3e-19
Identities = 46/159 (28%), Positives = 88/159 (55%), Gaps = 1/159 (0%)
Frame = +2

Query: 26 LIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKE 205
L+ K GL+ D+ + + ++ MY KCGS+ D VF N+ D V W ++A Y ++
Sbjct: 580 LVEKAGLEKDIRILTTLIKMYSKCGSLRDAYSVFKNVQEKDVVCWNAMLAAYNHSDHGQD 639

Query: 206 ALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIG 385
AL+LF++M+ EG +P T +L AC+++GAI+ GK+ H+ + E D ++
Sbjct: 640 ALKLFQQMRLEGVNPDSATYTSVLNACARLGAIEHGKKFHTQLKEAAMETDTRHYACMVA 699

Query: 386 MYAKSGNLEDSQKVFDQ-TSKRDVVTWSELISGYSEHED 499
++ L+++++ ++ +S+ D + W L+ H +
Sbjct: 700 ALGRASLLKEAEEFIEEISSESDALMWESLLVACRIHHN 738



Score = 65.5 bits (158), Expect = 1e-09
Identities = 28/73 (38%), Positives = 48/73 (65%)
Frame = +2

Query: 275 LKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYAKSGNLEDSQKVFDQTSKRDV 454
L+ C + ++ +GK++H ++E D+Y N+LI MY+K G++ED+ VF +DV
Sbjct: 58 LQECVQAKSLAEGKKVHDHMRSAQFEPDIYLNNMLISMYSKCGSIEDANNVFQSMEDKDV 117

Query: 455 VTWSELISGYSEH 493
V+W+ +ISGY+ H
Sbjct: 118 VSWNAMISGYALH 130


>tr|B8LQA8|B8LQA8_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 795

Score = 129 bits (325), Expect = 6e-29
Identities = 60/157 (38%), Positives = 100/157 (63%)
Frame = +2

Query: 17 HDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQAR 196
H+ +IA+ G + D+ V + + MY KCGS+E+ ++VF+ M + D V+W +IAGY + +
Sbjct: 143 HEDIIAR-GFESDVIVGTALASMYTKCGSLENARQVFDRMPKRDVVSWNAIIAGYSQNGQ 201

Query: 197 TKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNV 376
EAL LF EMQ G P+ T++ ++ C+ + A++QGK++H ++ E D+ N
Sbjct: 202 PYEALALFSEMQVNGIKPNSSTLVSVMPVCAHLLALEQGKQIHCYAIRSGIESDVLVVNG 261

Query: 377 LIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYS 487
L+ MYAK GN+ + K+F++ RDV +W+ +I GYS
Sbjct: 262 LVNMYAKCGNVNTAHKLFERMPIRDVASWNAIIGGYS 298



Score = 124 bits (310), Expect = 3e-27
Identities = 57/164 (34%), Positives = 97/164 (59%)
Frame = +2

Query: 2 EQGAAHDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGY 181
EQG + G++ D+ V + +++MY KCG+V K+F M D +W +I GY
Sbjct: 238 EQGKQIHCYAIRSGIESDVLVVNGLVNMYAKCGNVNTAHKLFERMPIRDVASWNAIIGGY 297

Query: 182 IEQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDL 361
++ EAL F MQ G P+ T++ +L AC+ + A++QG+++H ++ +E +
Sbjct: 298 SLNSQHHEALAFFNRMQVRGIKPNSITMVSVLPACAHLFALEQGQQIHGYAIRSGFESND 357

Query: 362 YFCNVLIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
N L+ MYAK GN+ + K+F++ K++VV W+ +ISGYS+H
Sbjct: 358 VVGNALVNMYAKCGNVNSAYKLFERMPKKNVVAWNAIISGYSQH 401



Score = 117 bits (292), Expect = 4e-25
Identities = 56/164 (34%), Positives = 96/164 (58%)
Frame = +2

Query: 2 EQGAAHDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGY 181
EQG + G + + V + +++MY KCG+V K+F M + + VAW +I+GY
Sbjct: 339 EQGQQIHGYAIRSGFESNDVVGNALVNMYAKCGNVNSAYKLFERMPKKNVVAWNAIISGY 398

Query: 182 IEQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDL 361
+ EAL LF EMQ +G P + I+ +L AC+ A++QGK++H ++ +E ++
Sbjct: 399 SQHGHPHEALALFIEMQAQGIKPDSFAIVSVLPACAHFLALEQGKQIHGYTIRSGFESNV 458

Query: 362 YFCNVLIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
L+ +YAK GN+ +QK+F++ ++DVV+W+ +I Y H
Sbjct: 459 VVGTGLVDIYAKCGNVNTAQKLFERMPEQDVVSWTTMILAYGIH 502



Score = 93.6 bits (231), Expect = 5e-18
Identities = 43/125 (34%), Positives = 77/125 (61%), Gaps = 1/125 (0%)
Frame = +2

Query: 137 LRHDSVAWGTLIAGYIEQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGK 316
+R+++V W I GY++ +AL L+ +MQR G +P + ++KAC + G+
Sbjct: 81 IRNNAVVWKETIIGYVKNGFWNKALRLYYQMQRTGINPDKLVFLSVIKACGSQSDLQAGR 140

Query: 317 ELHSLGVKFRYECDLYFCNVLIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH- 493
++H + +E D+ L MY K G+LE++++VFD+ KRDVV+W+ +I+GYS++
Sbjct: 141 KVHEDIIARGFESDVIVGTALASMYTKCGSLENARQVFDRMPKRDVVSWNAIIAGYSQNG 200

Query: 494 EDYDA 508
+ Y+A
Sbjct: 201 QPYEA 205



Score = 74.7 bits (182), Expect = 2e-12
Identities = 49/172 (28%), Positives = 80/172 (46%), Gaps = 8/172 (4%)
Frame = +2

Query: 2 EQGAAHDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGY 181
EQG + G + ++ V + ++D+Y KCG+V QK+F M D V+W T+I Y
Sbjct: 440 EQGKQIHGYTIRSGFESNVVVGTGLVDIYAKCGNVNTAQKLFERMPEQDVVSWTTMILAY 499

Query: 182 IEQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQG-------KELHSLGVK 340
++AL LF +MQ G+ +L ACS G +DQG K + L K
Sbjct: 500 GIHGHGEDALALFSKMQETGTKLDHIAFTAILTACSHAGLVDQGLQYFQCMKSDYGLAPK 559

Query: 341 FRYECDLYFCNVLIGMYAKSGNLEDSQKVFDQTS-KRDVVTWSELISGYSEH 493
+ Y C L+ + ++G+L+++ + S + D W L+ H
Sbjct: 560 LEH----YAC--LVDLLGRAGHLDEANGIIKNMSLEPDANVWGALLGACRIH 605


>tr|B8LKN6|B8LKN6_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 394

Score = 129 bits (323), Expect = 1e-28
Identities = 60/163 (36%), Positives = 106/163 (65%)
Frame = +2

Query: 17 HDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQAR 196
+D +I+K G ++D+ V + +++M+MKCGS+ED ++VF+ M + V+W +++GY +
Sbjct: 136 YDEIISK-GCEMDVIVENALINMFMKCGSIEDARRVFDKMCERNLVSWTAMVSGYAQGGF 194

Query: 197 TKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNV 376
EAL +F EMQ E + T+ +L AC+++ + QGKE+H ++ + + N
Sbjct: 195 ADEALRMFYEMQGEDVKANYVTVASVLPACAQLSDLQQGKEIHGYIIRRGLDLGIVVGNA 254

Query: 377 LIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEHEDYD 505
LI MYAK G++ +QKVFD+ +RDVV+W+ I+GY+++ +D
Sbjct: 255 LIDMYAKCGSIGSAQKVFDKMLQRDVVSWNVAIAGYAQNGRFD 297



Score = 117 bits (294), Expect = 2e-25
Identities = 51/140 (36%), Positives = 94/140 (67%), Gaps = 1/140 (0%)
Frame = +2

Query: 74 VLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALELFEEMQREGS-HP 250
+L++Y+KCGS+ D + F+NM + D W +I GY++ T+EALEL+ +MQ+ S +P
Sbjct: 52 LLNLYVKCGSLPDARLAFDNMTKGDVFPWNVMIGGYVKHGETREALELYHQMQKVSSTNP 111

Query: 251 SLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYAKSGNLEDSQKVF 430
YT +L AC+++ ++ +GK ++ + E D+ N LI M+ K G++ED+++VF
Sbjct: 112 DNYTYSSVLNACARLASLSEGKLIYDEIISKGCEMDVIVENALINMFMKCGSIEDARRVF 171

Query: 431 DQTSKRDVVTWSELISGYSE 490
D+ +R++V+W+ ++SGY++
Sbjct: 172 DKMCERNLVSWTAMVSGYAQ 191



Score = 86.7 bits (213), Expect = 6e-16
Identities = 53/164 (32%), Positives = 76/164 (46%), Gaps = 35/164 (21%)
Frame = +2

Query: 2 EQGAAHDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGY 181
+QG I + GLDL + V + ++DMY KCGS+ QKVF+ ML+ D V+W IAGY
Sbjct: 231 QQGKEIHGYIIRRGLDLGIVVGNALIDMYAKCGSIGSAQKVFDKMLQRDVVSWNVAIAGY 290

Query: 182 IEQARTKE-----------------------------------ALELFEEMQREGSHPSL 256
+ R E LELF++MQ G P+
Sbjct: 291 AQNGRFDECMELFRKMQCAGLKIDVITWNTLITAYAQNGYGDQTLELFQQMQLRGVKPNS 350

Query: 257 YTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGM 388
TI +L AC+ + A+ +GK +H L + + D+ N LI M
Sbjct: 351 ITIASVLSACAAVSALQEGKRIHDLVNRSECKSDICVGNALIDM 394



Score = 42.4 bits (98), Expect = 0.013
Identities = 22/74 (29%), Positives = 38/74 (51%)
Frame = +2

Query: 272 LLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYAKSGNLEDSQKVFDQTSKRD 451
LL C+K + + K++H+ + L+ +Y K G+L D++ FD +K D
Sbjct: 17 LLHLCTKAKTLAEAKQVHAHMLLTGILRIPSVETKLLNLYVKCGSLPDARLAFDNMTKGD 76

Query: 452 VVTWSELISGYSEH 493
V W+ +I GY +H
Sbjct: 77 VFPWNVMIGGYVKH 90


>tr|A9RSU9|A9RSU9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_177829 PE=4 SV=1
Length = 527

Score = 127 bits (318), Expect = 4e-28
Identities = 61/153 (39%), Positives = 94/153 (61%)
Frame = +2

Query: 35 KVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALE 214
K G D D+ VC+ ++ +Y K GSV+D + VF ML D ++W +I G + EA
Sbjct: 231 KAGFDSDMRVCNALVHVYSKSGSVDDARLVFEGMLDRDVISWSAMIGGLAQNGCGHEAFS 290

Query: 215 LFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYA 394
LF +MQREG P++ T + +L A + GA++ K++H+ K D CN L+ MYA
Sbjct: 291 LFLKMQREGVIPNVTTYVSILTASASAGALEWVKQVHNHARKAGLGSDFRVCNALVHMYA 350

Query: 395 KSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
KSG+++D++ VFDQ S R+V TW+ +I G ++H
Sbjct: 351 KSGSIDDARLVFDQMSVRNVFTWNAMIGGLAQH 383



Score = 122 bits (306), Expect = 1e-26
Identities = 54/159 (33%), Positives = 104/159 (65%)
Frame = +2

Query: 17 HDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQAR 196
HD ++ K G+D + +V + ++ +Y++CG V+D + VF+ +++ + W T+I GY E R
Sbjct: 22 HDCIL-KSGMDQNPYVANKLMRVYIRCGKVQDARHVFDKLVKKNVFNWTTMIGGYAEHGR 80

Query: 197 TKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNV 376
+A+E++ +M++EG P+ T + +LKAC+ + GKE+H+ + D+
Sbjct: 81 PADAIEVYNQMRQEGGRPNEVTYLSILKACACPVGLKWGKEIHAHISHGGFRSDVPVQTA 140

Query: 377 LIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
L+ MYAKSG+++D++ VFD+ ++R+V+TW+ +I G ++H
Sbjct: 141 LVNMYAKSGSIKDARLVFDEMAERNVITWNVMIGGLAQH 179



Score = 111 bits (278), Expect = 2e-23
Identities = 55/154 (35%), Positives = 89/154 (57%)
Frame = +2

Query: 35 KVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALE 214
K GL D VC+ ++ MY K GS++D + VF+ M + W +I G + +EA
Sbjct: 332 KAGLGSDFRVCNALVHMYAKSGSIDDARLVFDQMSVRNVFTWNAMIGGLAQHGCGQEAFS 391

Query: 215 LFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYA 394
LF M+REG P T + +L A + GA+ KE+H V+ + D+ N L+ MY
Sbjct: 392 LFLRMRREGVVPDAITYMSILNASASTGALGWVKEVHRQAVQAGLDSDVRVGNALVHMYC 451

Query: 395 KSGNLEDSQKVFDQTSKRDVVTWSELISGYSEHE 496
K+G++ D++ +FD +RDV+TW+ +ISG +++E
Sbjct: 452 KTGSISDARLMFDGMVERDVITWTAMISGLAQNE 485



Score = 109 bits (273), Expect = 7e-23
Identities = 55/157 (35%), Positives = 93/157 (59%), Gaps = 2/157 (1%)
Frame = +2

Query: 29 IAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEA 208
I+ G D+ V + +++MY K GS++D + VF+ M + + W +I G + +EA
Sbjct: 126 ISHGGFRSDVPVQTALVNMYAKSGSIKDARLVFDEMAERNVITWNVMIGGLAQHGFGQEA 185

Query: 209 LELFEEMQREGSHPSLYTIICLLKA--CSKMGAIDQGKELHSLGVKFRYECDLYFCNVLI 382
LF +MQ EG P T + +L A CS GA+ KE+H VK ++ D+ CN L+
Sbjct: 186 FSLFLQMQEEGFVPDSTTYLSILTATACSSAGALGWVKEVHRHAVKAGFDSDMRVCNALV 245

Query: 383 GMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
+Y+KSG+++D++ VF+ RDV++WS +I G +++
Sbjct: 246 HVYSKSGSVDDARLVFEGMLDRDVISWSAMIGGLAQN 282



Score = 64.7 bits (156), Expect = 2e-09
Identities = 31/88 (35%), Positives = 49/88 (55%)
Frame = +2

Query: 35 KVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALE 214
+ GLD D+ V + ++ MY K GS+ D + +F+ M+ D + W +I+G + +EA
Sbjct: 433 QAGLDSDVRVGNALVHMYCKTGSISDARLMFDGMVERDVITWTAMISGLAQNECGQEAFS 492

Query: 215 LFEEMQREGSHPSLYTIICLLKACSKMG 298
LF +MQREG P T +L C+ G
Sbjct: 493 LFLQMQREGFIPVATTYASILNVCTSTG 520



Score = 52.4 bits (124), Expect = 1e-05
Identities = 23/74 (31%), Positives = 44/74 (59%)
Frame = +2

Query: 272 LLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYAKSGNLEDSQKVFDQTSKRD 451
+L+ C K + K++H +K + + Y N L+ +Y + G ++D++ VFD+ K++
Sbjct: 5 VLQRCFKHKDLTSVKQVHDCILKSGMDQNPYVANKLMRVYIRCGKVQDARHVFDKLVKKN 64

Query: 452 VVTWSELISGYSEH 493
V W+ +I GY+EH
Sbjct: 65 VFNWTTMIGGYAEH 78


>tr|A7PPB6|A7PPB6_VITVI Chromosome chr8 scaffold_23, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00021587001
PE=4 SV=1
Length = 633

Score = 126 bits (317), Expect = 5e-28
Identities = 55/156 (35%), Positives = 99/156 (63%)
Frame = +2

Query: 26 LIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKE 205
++ K GLDLD FVC+ ++DMY+KC +ED + +F+ M D V W +I GY E + E
Sbjct: 185 IVYKFGLDLDHFVCAALVDMYVKCREIEDARFLFDKMQERDLVTWTVMIGGYAECGKANE 244

Query: 206 ALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIG 385
+L LFE+M+ EG P ++ ++ AC+K+GA+ + + + + +++ D+ +I
Sbjct: 245 SLVLFEKMREEGVVPDKVAMVTVVFACAKLGAMHKARIIDDYIQRKKFQLDVILGTAMID 304

Query: 386 MYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
MYAK G +E ++++FD+ +++V++WS +I+ Y H
Sbjct: 305 MYAKCGCVESAREIFDRMEEKNVISWSAMIAAYGYH 340



Score = 93.6 bits (231), Expect = 5e-18
Identities = 43/150 (28%), Positives = 83/150 (55%)
Frame = +2

Query: 41 GLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALELF 220
G+ ++ V + ++ Y +++D +F+ M DSV+W ++ G+ + F
Sbjct: 89 GMLENIVVANKLIYFYSYYRALDDAYGLFDGMCVRDSVSWSVMVGGFAKVGDYINCFGTF 148

Query: 221 EEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYAKS 400
E+ R G+ P YT+ +++AC + + G+ +H + KF + D + C L+ MY K
Sbjct: 149 RELIRCGARPDNYTLPFVIRACRDLKNLQMGRLIHHIVYKFGLDLDHFVCAALVDMYVKC 208

Query: 401 GNLEDSQKVFDQTSKRDVVTWSELISGYSE 490
+ED++ +FD+ +RD+VTW+ +I GY+E
Sbjct: 209 REIEDARFLFDKMQERDLVTWTVMIGGYAE 238



Score = 82.0 bits (201), Expect = 1e-14
Identities = 46/171 (26%), Positives = 85/171 (49%), Gaps = 7/171 (4%)
Frame = +2

Query: 8 GAAH-----DILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLI 172
GA H D I + LD+ + + ++DMY KCG VE +++F+ M + ++W +I
Sbjct: 275 GAMHKARIIDDYIQRKKFQLDVILGTAMIDMYAKCGCVESAREIFDRMEEKNVISWSAMI 334

Query: 173 AGYIEQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQG-KELHSLGVKFRY 349
A Y + ++AL+LF M G P T+ LL ACS G +++G + S+ +
Sbjct: 335 AAYGYHGQGRKALDLFRMMLSSGMLPDKITLASLLYACSHAGLVEEGLRFFSSMWEDYSV 394

Query: 350 ECDLYFCNVLIGMYAKSGNLEDSQKVF-DQTSKRDVVTWSELISGYSEHED 499
D+ ++ + ++G L+++ K+ T ++D W + H+D
Sbjct: 395 RTDVKHYTCVVDLLGRAGRLDEAFKLIKSMTIEKDEGLWGAFLGACRTHKD 445



Score = 34.7 bits (78), Expect = 2.7
Identities = 16/49 (32%), Positives = 28/49 (57%)
Frame = +2

Query: 356 DLYFCNVLIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEHEDY 502
++ N LI Y+ L+D+ +FD RD V+WS ++ G+++ DY
Sbjct: 93 NIVVANKLIYFYSYYRALDDAYGLFDGMCVRDSVSWSVMVGGFAKVGDY 141


>tr|A5C1S9|A5C1S9_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_014227 PE=4 SV=1
Length = 1309

Score = 126 bits (317), Expect = 5e-28
Identities = 55/156 (35%), Positives = 99/156 (63%)
Frame = +2

Query: 26 LIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKE 205
++ K GLDLD FVC+ ++DMY+KC +ED + +F+ M D V W +I GY E + E
Sbjct: 185 IVYKFGLDLDHFVCAALVDMYVKCREIEDARFLFDKMQERDLVTWTVMIGGYAECGKANE 244

Query: 206 ALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIG 385
+L LFE+M+ EG P ++ ++ AC+K+GA+ + + + + +++ D+ +I
Sbjct: 245 SLVLFEKMREEGVVPDKVAMVTVVFACAKLGAMHKARIIDDYIQRKKFQLDVILGTAMID 304

Query: 386 MYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
MYAK G +E ++++FD+ +++V++WS +I+ Y H
Sbjct: 305 MYAKCGCVESAREIFDRMEEKNVISWSAMIAAYGYH 340



Score = 122 bits (306), Expect = 1e-26
Identities = 53/156 (33%), Positives = 97/156 (62%)
Frame = +2

Query: 26 LIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKE 205
++ K GLDLD FVC+ ++DMY KC +ED + +F+ M D V W +I GY E E
Sbjct: 861 IVYKFGLDLDHFVCAALVDMYGKCREIEDARFLFDKMXERDLVTWTVMIGGYAECGNANE 920

Query: 206 ALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIG 385
+L LF++M+ EG P ++ ++ AC+K+GA+ + + + + +++ D+ +I
Sbjct: 921 SLVLFDKMREEGVVPDKVAMVTVVFACAKLGAMHKARTIDDYIQRKKFQLDVILGTAMID 980

Query: 386 MYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
M+AK G +E ++++FD+ +++V++WS +I+ Y H
Sbjct: 981 MHAKCGCVESAREIFDRMEEKNVISWSAMIAAYGYH 1016



Score = 95.9 bits (237), Expect = 1e-18
Identities = 44/150 (29%), Positives = 83/150 (55%)
Frame = +2

Query: 41 GLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALELF 220
G+ +L V + ++ Y +++D +F+ M DSV+W ++ G+ + F
Sbjct: 765 GMLQNLIVANKLVXFYSYYRALDDAYGLFDGMCVRDSVSWSVMVGGFAKVGDYMNCFGTF 824

Query: 221 EEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYAKS 400
E+ R G+ P YT+ +++AC + + G+ +H + KF + D + C L+ MY K
Sbjct: 825 RELIRCGARPDNYTLPFVIRACRDLKNLQMGRLIHHIVYKFGLDLDHFVCAALVDMYGKC 884

Query: 401 GNLEDSQKVFDQTSKRDVVTWSELISGYSE 490
+ED++ +FD+ +RD+VTW+ +I GY+E
Sbjct: 885 REIEDARFLFDKMXERDLVTWTVMIGGYAE 914



Score = 93.6 bits (231), Expect = 5e-18
Identities = 43/150 (28%), Positives = 83/150 (55%)
Frame = +2

Query: 41 GLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALELF 220
G+ ++ V + ++ Y +++D +F+ M DSV+W ++ G+ + F
Sbjct: 89 GMLENIVVANKLIYFYSYYRALDDAYGLFDGMCVRDSVSWSVMVGGFAKVGDYINCFGTF 148

Query: 221 EEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYAKS 400
E+ R G+ P YT+ +++AC + + G+ +H + KF + D + C L+ MY K
Sbjct: 149 RELIRCGARPDNYTLPFVIRACRDLKNLQMGRLIHHIVYKFGLDLDHFVCAALVDMYVKC 208

Query: 401 GNLEDSQKVFDQTSKRDVVTWSELISGYSE 490
+ED++ +FD+ +RD+VTW+ +I GY+E
Sbjct: 209 REIEDARFLFDKMQERDLVTWTVMIGGYAE 238



Score = 84.3 bits (207), Expect = 3e-15
Identities = 46/171 (26%), Positives = 87/171 (50%), Gaps = 7/171 (4%)
Frame = +2

Query: 8 GAAH-----DILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLI 172
GA H D I + LD+ + + ++DM+ KCG VE +++F+ M + ++W +I
Sbjct: 951 GAMHKARTIDDYIQRKKFQLDVILGTAMIDMHAKCGCVESAREIFDRMEEKNVISWSAMI 1010

Query: 173 AGYIEQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHS-LGVKFRY 349
A Y + ++AL+LF M R G P+ T++ LL ACS G +++G S + +
Sbjct: 1011 AAYGYHGQGRKALDLFPMMLRSGILPNKITLVSLLYACSHAGLVEEGLRFFSXMWEDYSV 1070

Query: 350 ECDLYFCNVLIGMYAKSGNLEDSQK-VFDQTSKRDVVTWSELISGYSEHED 499
D+ ++ + ++G L+++ K + T ++D W + H+D
Sbjct: 1071 RXDVKHYTCVVDLLGRAGRLDEALKLIXSMTXEKDEGLWGAFLGACRTHKD 1121



Score = 82.0 bits (201), Expect = 1e-14
Identities = 46/171 (26%), Positives = 85/171 (49%), Gaps = 7/171 (4%)
Frame = +2

Query: 8 GAAH-----DILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLI 172
GA H D I + LD+ + + ++DMY KCG VE +++F+ M + ++W +I
Sbjct: 275 GAMHKARIIDDYIQRKKFQLDVILGTAMIDMYAKCGCVESAREIFDRMEEKNVISWSAMI 334

Query: 173 AGYIEQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQG-KELHSLGVKFRY 349
A Y + ++AL+LF M G P T+ LL ACS G +++G + S+ +
Sbjct: 335 AAYGYHGQGRKALDLFPMMLSSGMLPDKITLASLLYACSHAGLVEEGLRFFSSMWEDYSV 394

Query: 350 ECDLYFCNVLIGMYAKSGNLEDSQKVF-DQTSKRDVVTWSELISGYSEHED 499
D+ ++ + ++G L+++ K+ T ++D W + H+D
Sbjct: 395 RTDVKHYTCVVDLLGRAGRLDEALKLIKSMTIEKDEGLWGAFLGACRTHKD 445



Score = 35.8 bits (81), Expect = 1.2
Identities = 16/49 (32%), Positives = 28/49 (57%)
Frame = +2

Query: 356 DLYFCNVLIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEHEDY 502
+L N L+ Y+ L+D+ +FD RD V+WS ++ G+++ DY
Sbjct: 769 NLIVANKLVXFYSYYRALDDAYGLFDGMCVRDSVSWSVMVGGFAKVGDY 817



Score = 34.7 bits (78), Expect = 2.7
Identities = 16/49 (32%), Positives = 28/49 (57%)
Frame = +2

Query: 356 DLYFCNVLIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEHEDY 502
++ N LI Y+ L+D+ +FD RD V+WS ++ G+++ DY
Sbjct: 93 NIVVANKLIYFYSYYRALDDAYGLFDGMCVRDSVSWSVMVGGFAKVGDY 141


>tr|Q7XHP5|Q7XHP5_ORYSJ Os07g0239600 protein OS=Oryza sativa subsp.
japonica GN=P0565A07.138 PE=4 SV=1
Length = 720

Score = 125 bits (314), Expect = 1e-27
Identities = 58/160 (36%), Positives = 98/160 (61%), Gaps = 3/160 (1%)
Frame = +2

Query: 23 ILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNN---MLRHDSVAWGTLIAGYIEQA 193
+LIA L+ D FV S ++DMY KCG +E VF++ + R + AW T++AGY++
Sbjct: 270 VLIA--ALEGDAFVRSSLMDMYCKCGLLEAAASVFDHWSPLTRDMNFAWSTMVAGYVQNG 327

Query: 194 RTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCN 373
R +EAL+LF M REG +T+ + AC+ +G ++QG+++H K Y+ D +
Sbjct: 328 REEEALDLFRRMLREGVAADRFTLTSVAAACANVGMVEQGRQVHGCVEKLWYKLDAPLAS 387

Query: 374 VLIGMYAKSGNLEDSQKVFDQTSKRDVVTWSELISGYSEH 493
++ MYAK GNLED++ +FD+ +++ W+ ++ Y+ H
Sbjct: 388 AIVDMYAKCGNLEDARSIFDRACTKNIAVWTSMLCSYASH 427



Score = 85.1 bits (209), Expect = 2e-15
Identities = 45/168 (26%), Positives = 87/168 (51%), Gaps = 3/168 (1%)
Frame = +2

Query: 2 EQGAAHDILIAKVGLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGY 181
EQG + K+ LD + S ++DMY KCG++ED + +F+ + W +++ Y
Sbjct: 365 EQGRQVHGCVEKLWYKLDAPLASAIVDMYAKCGNLEDARSIFDRACTKNIAVWTSMLCSY 424

Query: 182 IEQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAIDQGKELHSLGVKFRYEC-- 355
+ + A+ELFE M E P+ T++ +L ACS +G + +G EL+ ++ Y
Sbjct: 425 ASHGQGRIAIELFERMTAEKMTPNEITLVGVLSACSHVGLVSEG-ELYFKQMQEEYGIVP 483

Query: 356 DLYFCNVLIGMYAKSGNLEDSQKVFDQTS-KRDVVTWSELISGYSEHE 496
+ N ++ +Y +SG L+ ++ ++ + + + W L+S H+
Sbjct: 484 SIEHYNCIVDLYGRSGLLDKAKNFIEENNINHEAIVWKTLLSACRLHQ 531



Score = 76.3 bits (186), Expect = 8e-13
Identities = 38/143 (26%), Positives = 72/143 (50%), Gaps = 1/143 (0%)
Frame = +2

Query: 74 VLDMYMKCGSVEDGQKVFNNMLRHDSVAWGTLIAGYIEQARTKEALELFEEMQREG-SHP 250
VL +++ D + VF+ + W I+G + R + + F EM EG + P
Sbjct: 51 VLRFWVRRRRFHDARGVFDERPTRTAPVWTLTISGCARRGRYADGMRAFAEMLAEGEATP 110

Query: 251 SLYTIICLLKACSKMGAIDQGKELHSLGVKFRYECDLYFCNVLIGMYAKSGNLEDSQKVF 430
+ + + +++ C+ MG ++ GK +H ++ D+ CN ++ MYAK G E +++VF
Sbjct: 111 NAFVLAAVVRCCAGMGDVESGKRVHGWMLRNGVHLDVVLCNAVLDMYAKCGQFERARRVF 170

Query: 431 DQTSKRDVVTWSELISGYSEHED 499
++RD V+W+ I + D
Sbjct: 171 GAMAERDAVSWNIAIGACIQSGD 193



Score = 72.4 bits (176), Expect = 1e-11
Identities = 51/185 (27%), Positives = 79/185 (42%), Gaps = 34/185 (18%)
Frame = +2

Query: 41 GLDLDLFVCSIVLDMYMKCGSVEDGQKVFNNMLRHDSVAWG------------------- 163
G+ LD+ +C+ VLDMY KCG E ++VF M D+V+W
Sbjct: 142 GVHLDVVLCNAVLDMYAKCGQFERARRVFGAMAERDAVSWNIAIGACIQSGDILGSMQLF 201

Query: 164 ------------TLIAGYIEQARTKEALELFEEMQREGSHPSLYTIICLLKACSKMGAID 307
T+I+G + +AL M + G + YT + D
Sbjct: 202 DESPLRDTTSWNTIISGLMRSGHAADALSHLRRMAQAGVVFNHYTYSTAFVLAGMLLLPD 261

Query: 308 QGKELHSLGVKFRYECDLYFCNVLIGMYAKSGNLEDSQKVFDQTS--KRDV-VTWSELIS 478
G++LH + E D + + L+ MY K G LE + VFD S RD+ WS +++
Sbjct: 262 LGRQLHGRVLIAALEGDAFVRSSLMDMYCKCGLLEAAASVFDHWSPLTRDMNFAWSTMVA 321

Query: 479 GYSEH 493
GY ++
Sbjct: 322 GYVQN 326