BP916580
Clone id YMU001_000089_C05
Library
Length 521
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000089_C05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
AACTGGAAGAATTCGCGGCCTCGGTGAATGAACCCCACGTCTCCCTCTTCCACCCTGAGG
AGGGTAGTTTTCCTCGTTTAGCTTCAACTCTTCAAAACGATCATGCACCCACCGTTGCTC
ATCCTTGGCCTCCCATAGCTTTCTTCCTCCAGCACTACGCCTTGCACGAATTGCTCCATT
GTTTCGAAATCGGTCATCGTGCATATAGAAAGCCCCAATTGTAGGTACAACAAAAGGTTC
TGCATTTTGCTTATCCTCCTCAAGTCCTTCCTTATTGGCACTTCCTTTTGAAAGTTCCGT
TGCACCAAGGGCTTCCCCTGCAACATGGTCAGTGATCCGTCTTTGCTGGCTGAACTTCTC
TTCCCCATTGTCATCTTCCTCACTTGCATCACGAGTTCTTGCTGCATCATCACTATCTGC
ATATCCTTCTTCCTCATCCTCCTCCTCTTCTTGATCCTCGTCTTCATCAGGAGGTGCTCC
CTCATCATCTTCATCATCATACACACCCTCCCCTTCCTTGG
■■Homology search results ■■ -
sp_hit_id Q8K3X0
Definition sp|Q8K3X0|CASC3_RAT Protein CASC3 OS=Rattus norvegicus
Align length 97
Score (bit) 45.8
E-value 0.0001
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916580|Adiantum capillus-veneris mRNA, clone:
YMU001_000089_C05.
(501 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8K3X0|CASC3_RAT Protein CASC3 OS=Rattus norvegicus GN=Casc3 ... 46 1e-04
sp|Q8K3W3|CASC3_MOUSE Protein CASC3 OS=Mus musculus GN=Casc3 PE=... 46 1e-04
sp|O15234|CASC3_HUMAN Protein CASC3 OS=Homo sapiens GN=CASC3 PE=... 46 1e-04
sp|B0V4K1|KATG_ACIBY Catalase-peroxidase OS=Acinetobacter bauman... 33 0.57
sp|A3M1S3|KATG_ACIBT Catalase-peroxidase OS=Acinetobacter bauman... 33 0.57
sp|B2I352|KATG_ACIBC Catalase-peroxidase OS=Acinetobacter bauman... 33 0.57
sp|Q58899|WECB_METJA UDP-N-acetylglucosamine 2-epimerase OS=Meth... 31 2.8
sp|Q0CE91|RPC3_ASPTN DNA-directed RNA polymerase III subunit rpc... 30 4.8
sp|Q32N19|ZN750_XENLA Protein ZNF750 OS=Xenopus laevis GN=znf750... 30 4.9
sp|B2VFG0|KATG_ERWT9 Catalase-peroxidase OS=Erwinia tasmaniensis... 30 6.3
sp|A7MJS4|KATG_ENTS8 Catalase-peroxidase OS=Enterobacter sakazak... 30 8.2
sp|P08975|LH15_EUGGR Light-harvesting complex I LH35 proteins (F... 30 8.3

>sp|Q8K3X0|CASC3_RAT Protein CASC3 OS=Rattus norvegicus GN=Casc3
PE=1 SV=1
Length = 699

Score = 45.8 bits (107), Expect = 1e-04
Identities = 32/97 (32%), Positives = 46/97 (47%), Gaps = 4/97 (4%)
Frame = -3

Query: 346 GEEKFSQQRRIT-DHVAGEALGATELSKGSANKEG---LEEDKQNAEPFVVPTIGAFYMH 179
GEEK + +T + +G+ +TE + K+G L++D+ P +P G F+ H
Sbjct: 129 GEEKPESKGTVTGERQSGDGQESTEPVENKVGKKGPKHLDDDEDRKNPAYIPRKGLFFEH 188

Query: 178 DDRFXXXXXXXXXXXXXXRKLWEAKDEQRWVHDRFEE 68
D R RKLW KDE RW HD+F E
Sbjct: 189 DLR-GQTQEEEVRPKGRQRKLW--KDEGRWEHDKFRE 222


>sp|Q8K3W3|CASC3_MOUSE Protein CASC3 OS=Mus musculus GN=Casc3 PE=1
SV=2
Length = 697

Score = 45.8 bits (107), Expect = 1e-04
Identities = 32/97 (32%), Positives = 46/97 (47%), Gaps = 4/97 (4%)
Frame = -3

Query: 346 GEEKFSQQRRIT-DHVAGEALGATELSKGSANKEG---LEEDKQNAEPFVVPTIGAFYMH 179
GEEK + +T + +G+ +TE + K+G L++D+ P +P G F+ H
Sbjct: 129 GEEKPESKGTVTGERQSGDGQESTEPVENKVGKKGPKHLDDDEDRKNPAYIPRKGLFFEH 188

Query: 178 DDRFXXXXXXXXXXXXXXRKLWEAKDEQRWVHDRFEE 68
D R RKLW KDE RW HD+F E
Sbjct: 189 DLR-GQTQEEEVRPKGRQRKLW--KDEGRWEHDKFRE 222


>sp|O15234|CASC3_HUMAN Protein CASC3 OS=Homo sapiens GN=CASC3 PE=1
SV=2
Length = 703

Score = 45.8 bits (107), Expect = 1e-04
Identities = 32/97 (32%), Positives = 46/97 (47%), Gaps = 4/97 (4%)
Frame = -3

Query: 346 GEEKFSQQRRIT-DHVAGEALGATELSKGSANKEG---LEEDKQNAEPFVVPTIGAFYMH 179
GEEK + +T + +G+ +TE + K+G L++D+ P +P G F+ H
Sbjct: 132 GEEKPDTKSTVTGERQSGDGQESTEPVENKVGKKGPKHLDDDEDRKNPAYIPRKGLFFEH 191

Query: 178 DDRFXXXXXXXXXXXXXXRKLWEAKDEQRWVHDRFEE 68
D R RKLW KDE RW HD+F E
Sbjct: 192 DLR-GQTQEEEVRPKGRQRKLW--KDEGRWEHDKFRE 225


>sp|B0V4K1|KATG_ACIBY Catalase-peroxidase OS=Acinetobacter baumannii
(strain AYE) GN=katG PE=3 SV=1
Length = 718

Score = 33.5 bits (75), Expect = 0.57
Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 2/60 (3%)
Frame = -3

Query: 346 GEEKFSQQRRITDHVAGEALGATELSKGSANKEGLEE--DKQNAEPFVVPTIGAFYMHDD 173
G+EK R ++ +AG L ATE+ N EG + D ++A PF+ T G M D+
Sbjct: 191 GDEKEWLAHRNSEALAGSNLAATEMGLIYVNPEGPQASGDPRSAAPFIRATFGNMAMDDE 250


>sp|A3M1S3|KATG_ACIBT Catalase-peroxidase OS=Acinetobacter baumannii
(strain ATCC 17978 / NCDC KC 755) GN=katG PE=3 SV=2
Length = 718

Score = 33.5 bits (75), Expect = 0.57
Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 2/60 (3%)
Frame = -3

Query: 346 GEEKFSQQRRITDHVAGEALGATELSKGSANKEGLEE--DKQNAEPFVVPTIGAFYMHDD 173
G+EK R ++ +AG L ATE+ N EG + D ++A PF+ T G M D+
Sbjct: 191 GDEKEWLAHRNSEALAGSNLAATEMGLIYVNPEGPQASGDPRSAAPFIRATFGNMAMDDE 250


>sp|B2I352|KATG_ACIBC Catalase-peroxidase OS=Acinetobacter baumannii
(strain ACICU) GN=katG PE=3 SV=1
Length = 718

Score = 33.5 bits (75), Expect = 0.57
Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 2/60 (3%)
Frame = -3

Query: 346 GEEKFSQQRRITDHVAGEALGATELSKGSANKEGLEE--DKQNAEPFVVPTIGAFYMHDD 173
G+EK R ++ +AG L ATE+ N EG + D ++A PF+ T G M D+
Sbjct: 191 GDEKEWLAHRNSEALAGSNLAATEMGLIYVNPEGPQASGDPRSAAPFIRATFGNMAMDDE 250


>sp|Q58899|WECB_METJA UDP-N-acetylglucosamine 2-epimerase
OS=Methanocaldococcus jannaschii GN=wecB PE=3 SV=1
Length = 366

Score = 31.2 bits (69), Expect = 2.8
Identities = 12/31 (38%), Positives = 21/31 (67%)
Frame = -3

Query: 322 RRITDHVAGEALGATELSKGSANKEGLEEDK 230
R +TDH++ TE++K + +EG+EE+K
Sbjct: 133 RVLTDHISSYLFAPTEIAKNNLLREGIEENK 163


>sp|Q0CE91|RPC3_ASPTN DNA-directed RNA polymerase III subunit rpc3
OS=Aspergillus terreus (strain NIH 2624) GN=rpc82 PE=3
SV=1
Length = 650

Score = 30.4 bits (67), Expect = 4.8
Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 1/58 (1%)
Frame = -3

Query: 349 NGEEKFSQQRRITDHVAGEALGATELSKGSANKEGLEEDKQNAEPFVV-PTIGAFYMH 179
NG + ++ + V GE + + G +E LEE ++ A+PF++ PT+ A H
Sbjct: 137 NGNHEQPEKEIEGEGVEGEGIEEEGHTNGVNGEEALEEQEEQAQPFLLHPTLKALAAH 194


>sp|Q32N19|ZN750_XENLA Protein ZNF750 OS=Xenopus laevis GN=znf750
PE=2 SV=1
Length = 674

Score = 30.4 bits (67), Expect = 4.9
Identities = 29/95 (30%), Positives = 35/95 (36%), Gaps = 1/95 (1%)
Frame = +1

Query: 25 LFHPEEGSFPRLASTLQNDHAPTVAHPWPPIAFFLQHYALHELLHCFEIGHRAYRKPQL* 204
LF E P L+ D P + HP P L H YR Q
Sbjct: 244 LFPQTECENPMLSIYSTPDQRPYLPHPLQPSGLPLPKPINAPFEH--------YRLLQQF 295

Query: 205 VQQKVLHFA-YPPQVLPYWHFLLKVPLHQGLPLQH 306
Q LH+ Y P PY+ + LKVP GL +H
Sbjct: 296 QQNPQLHYGFYRPTEHPYFSYGLKVPPAPGLSKEH 330


>sp|B2VFG0|KATG_ERWT9 Catalase-peroxidase OS=Erwinia tasmaniensis
(strain DSM 17950 / Et1/99) GN=katG PE=3 SV=1
Length = 729

Score = 30.0 bits (66), Expect = 6.3
Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 2/60 (3%)
Frame = -3

Query: 346 GEEKFSQQRRITDHVAGEALGATELSKGSANKEGLEE--DKQNAEPFVVPTIGAFYMHDD 173
GEEK R + +A LGATE+ N EG E + +A P + T G M+D+
Sbjct: 201 GEEKEWLTHRHPESLANAPLGATEMGLIYVNPEGPEASGNPASAAPAIRATFGNMGMNDE 260


tr_hit_id B8AB54
Definition tr|B8AB54|B8AB54_ORYSI Putative uncharacterized protein OS=Oryza sativa subsp. indica
Align length 84
Score (bit) 93.6
E-value 5.0e-18
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916580|Adiantum capillus-veneris mRNA, clone:
YMU001_000089_C05.
(501 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8AB54|B8AB54_ORYSI Putative uncharacterized protein OS=Oryza... 94 5e-18
tr|Q5ZB64|Q5ZB64_ORYSJ Glycine-rich protein-like (Putative uncha... 89 1e-16
tr|Q0JLJ7|Q0JLJ7_ORYSJ Os01g0595100 protein OS=Oryza sativa subs... 89 1e-16
tr|B7FAK7|B7FAK7_ORYSJ cDNA, clone: J100082C16, full insert sequ... 89 1e-16
tr|A9TAC2|A9TAC2_PHYPA Predicted protein OS=Physcomitrella paten... 87 6e-16
tr|B4F8T1|B4F8T1_MAIZE Putative uncharacterized protein OS=Zea m... 84 3e-15
tr|A7P7F3|A7P7F3_VITVI Chromosome chr9 scaffold_7, whole genome ... 80 5e-14
tr|Q9S770|Q9S770_ARATH Putative uncharacterized protein F19K16.3... 75 1e-12
tr|Q93ZJ9|Q93ZJ9_ARATH At1g80000/F19K16_3 OS=Arabidopsis thalian... 75 1e-12
tr|Q75KU2|Q75KU2_ORYSJ Putative uncharacterized protein OJ1014_C... 75 2e-12
tr|Q6I5G3|Q6I5G3_ORYSJ Os05g0534600 protein OS=Oryza sativa subs... 75 2e-12
tr|A2Y6V8|A2Y6V8_ORYSI Putative uncharacterized protein OS=Oryza... 75 2e-12
tr|A7PET0|A7PET0_VITVI Chromosome chr11 scaffold_13, whole genom... 71 3e-11
tr|Q5JL93|Q5JL93_ORYSJ Glycine-rich protein-like (Os01g0719400 p... 64 4e-09
tr|B8A8Q1|B8A8Q1_ORYSI Putative uncharacterized protein OS=Oryza... 64 4e-09
tr|Q8H1F3|Q8H1F3_ARATH Putative uncharacterized protein At1g1528... 60 4e-08
tr|A2ZXA4|A2ZXA4_ORYSJ Putative uncharacterized protein OS=Oryza... 60 4e-08
tr|Q9XI41|Q9XI41_ARATH F9L1.22 protein OS=Arabidopsis thaliana G... 57 5e-07
tr|Q8RXP2|Q8RXP2_ARATH Putative uncharacterized protein At1g1528... 57 6e-07
tr|A9TAC3|A9TAC3_PHYPA Predicted protein OS=Physcomitrella paten... 50 6e-05
tr|B6SRU8|B6SRU8_MAIZE Putative uncharacterized protein OS=Zea m... 49 1e-04
tr|Q801T5|Q801T5_XENLA MGC54001 protein OS=Xenopus laevis GN=cas... 49 2e-04
tr|A8I0K6|A8I0K6_CHLRE Predicted protein OS=Chlamydomonas reinha... 46 8e-04
tr|Q5CZI8|Q5CZI8_XENTR MLN51 protein OS=Xenopus tropicalis GN=ca... 46 0.001
tr|Q28D04|Q28D04_XENTR Cancer susceptibility candidate 3 OS=Xeno... 46 0.001
tr|Q3UT99|Q3UT99_MOUSE Putative uncharacterized protein OS=Mus m... 46 0.001
tr|A3KFP7|A3KFP7_MOUSE Cancer susceptibility candidate 3 OS=Mus ... 46 0.001
tr|B4DKR6|B4DKR6_HUMAN cDNA FLJ60283, highly similar to Protein ... 46 0.001
tr|A5D7H5|A5D7H5_BOVIN CASC3 protein OS=Bos taurus GN=CASC3 PE=2... 45 0.001
tr|Q5CZI9|Q5CZI9_XENLA MLN51 protein OS=Xenopus laevis GN=mln51 ... 45 0.002

>tr|B8AB54|B8AB54_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_02679 PE=4 SV=1
Length = 667

Score = 93.6 bits (231), Expect = 5e-18
Identities = 46/84 (54%), Positives = 54/84 (64%)
Frame = -3

Query: 268 KGSANKEGLEEDKQNAEPFVVPTIGAFYMHDDRFXXXXXXXXXXXXXXRKLWEAKDEQRW 89
+G A EG E+K+ EPF VPT GAFYMHDDRF RKLW+AKD+Q W
Sbjct: 148 EGEAAVEGDGEEKKEQEPFAVPTSGAFYMHDDRFQEESRGRRRRMFGGRKLWDAKDDQAW 207

Query: 88 VHDRFEELKLNEENYPPQGGRGRR 17
VHDRFEE+ L+EE+Y GRG R
Sbjct: 208 VHDRFEEMNLHEEHYEVVRGRGPR 231


>tr|Q5ZB64|Q5ZB64_ORYSJ Glycine-rich protein-like (Putative
uncharacterized protein) OS=Oryza sativa subsp. japonica
GN=B1103C09.12 PE=4 SV=1
Length = 701

Score = 89.0 bits (219), Expect = 1e-16
Identities = 45/84 (53%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
Frame = -3

Query: 268 KGSANKEGLEEDKQNAEPFVVPTIGAFYMHDDRFXXXXXXXXXXXXXXRKLWEAKDEQRW 89
+G A EG E+K+ EPF VPT GAFYMHDDRF RKLW+AKD+Q W
Sbjct: 148 EGEAAVEGDGEEKKEQEPFAVPTSGAFYMHDDRFQEESRGRRRRMFGGRKLWDAKDDQAW 207

Query: 88 VHDRFEELKLNEENYPPQG-GRGR 20
VHDRFEE+ L+EE+Y + RGR
Sbjct: 208 VHDRFEEMNLHEEHYEDKRMSRGR 231


>tr|Q0JLJ7|Q0JLJ7_ORYSJ Os01g0595100 protein OS=Oryza sativa subsp.
japonica GN=Os01g0595100 PE=4 SV=1
Length = 837

Score = 89.0 bits (219), Expect = 1e-16
Identities = 45/84 (53%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
Frame = -3

Query: 268 KGSANKEGLEEDKQNAEPFVVPTIGAFYMHDDRFXXXXXXXXXXXXXXRKLWEAKDEQRW 89
+G A EG E+K+ EPF VPT GAFYMHDDRF RKLW+AKD+Q W
Sbjct: 148 EGEAAVEGDGEEKKEQEPFAVPTSGAFYMHDDRFQEESRGRRRRMFGGRKLWDAKDDQAW 207

Query: 88 VHDRFEELKLNEENYPPQG-GRGR 20
VHDRFEE+ L+EE+Y + RGR
Sbjct: 208 VHDRFEEMNLHEEHYEDKRMSRGR 231


>tr|B7FAK7|B7FAK7_ORYSJ cDNA, clone: J100082C16, full insert
sequence OS=Oryza sativa subsp. japonica PE=2 SV=1
Length = 690

Score = 89.0 bits (219), Expect = 1e-16
Identities = 45/84 (53%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
Frame = -3

Query: 268 KGSANKEGLEEDKQNAEPFVVPTIGAFYMHDDRFXXXXXXXXXXXXXXRKLWEAKDEQRW 89
+G A EG E+K+ EPF VPT GAFYMHDDRF RKLW+AKD+Q W
Sbjct: 148 EGEAAVEGDGEEKKEQEPFAVPTSGAFYMHDDRFQEESRGRRRRMFGGRKLWDAKDDQAW 207

Query: 88 VHDRFEELKLNEENYPPQG-GRGR 20
VHDRFEE+ L+EE+Y + RGR
Sbjct: 208 VHDRFEEMNLHEEHYEDKRMSRGR 231


>tr|A9TAC2|A9TAC2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_168895 PE=4 SV=1
Length = 497

Score = 86.7 bits (213), Expect = 6e-16
Identities = 50/94 (53%), Positives = 58/94 (61%), Gaps = 8/94 (8%)
Frame = -3

Query: 271 SKGSA------NKEGLEEDKQNAEPFVVPTIGAFYMHDDRF-XXXXXXXXXXXXXXRKLW 113
S+GSA KE EEDK+ AEPFVVPT GAFYMHDDR RKLW
Sbjct: 112 SQGSAAAGTTDGKEAGEEDKKEAEPFVVPTAGAFYMHDDRSRGVGGARPRRGVGGSRKLW 171

Query: 112 EAKDEQRWVHDRFEELKLNEENYPPQG-GRGRRG 14
EAKDE+ WVHD FEEL + +++Y +G RG RG
Sbjct: 172 EAKDEKPWVHDLFEELNVRDDSYSDEGLSRGGRG 205


>tr|B4F8T1|B4F8T1_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 530

Score = 84.3 bits (207), Expect = 3e-15
Identities = 45/90 (50%), Positives = 55/90 (61%), Gaps = 3/90 (3%)
Frame = -3

Query: 274 LSKGSANKEGLEEDKQNAEPFVVPTIGAFYMHDDRFXXXXXXXXXXXXXXRKLWEAKDEQ 95
L++G A EG E+++ EPF VPT GAFYMHDDRF RKLW+ KD Q
Sbjct: 5 LTEGEAKGEGGEKEQ---EPFAVPTSGAFYMHDDRFQEENRGRRRRMFGVRKLWDVKDNQ 61

Query: 94 RWVHDRFEELKLNEENYPPQ---GGRGRRG 14
WVHDRFEE+ L+++ Y Q GRG RG
Sbjct: 62 AWVHDRFEEMNLHDDFYEDQRMSRGRGGRG 91


>tr|A7P7F3|A7P7F3_VITVI Chromosome chr9 scaffold_7, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00034438001
PE=4 SV=1
Length = 361

Score = 80.1 bits (196), Expect = 5e-14
Identities = 37/76 (48%), Positives = 49/76 (64%)
Frame = -3

Query: 241 EEDKQNAEPFVVPTIGAFYMHDDRFXXXXXXXXXXXXXXRKLWEAKDEQRWVHDRFEELK 62
EE+K+ EPF VPT GAFYMHDDRF RKLWE+KD+++W HD+FEE+
Sbjct: 107 EEEKKENEPFAVPTAGAFYMHDDRFRDNAGGRHRRTLGGRKLWESKDDRKWGHDKFEEMT 166

Query: 61 LNEENYPPQGGRGRRG 14
+ E +Y +G R +G
Sbjct: 167 MQERHY-EEGRRNSKG 181


>tr|Q9S770|Q9S770_ARATH Putative uncharacterized protein F19K16.3
(F18B13.8 protein) OS=Arabidopsis thaliana GN=F19K16.3
PE=4 SV=1
Length = 656

Score = 75.5 bits (184), Expect = 1e-12
Identities = 32/73 (43%), Positives = 46/73 (63%)
Frame = -3

Query: 238 EDKQNAEPFVVPTIGAFYMHDDRFXXXXXXXXXXXXXXRKLWEAKDEQRWVHDRFEELKL 59
E+++ EPF VPT GAFYMHDDRF R+LW+++DE++W HD+FEE+
Sbjct: 124 EEQKKKEPFAVPTAGAFYMHDDRFQELDAASNRRMRGGRRLWQSRDERKWGHDKFEEMNT 183

Query: 58 NEENYPPQGGRGR 20
++ Y + RGR
Sbjct: 184 QKQQYDRRTSRGR 196


>tr|Q93ZJ9|Q93ZJ9_ARATH At1g80000/F19K16_3 OS=Arabidopsis thaliana
GN=At1g80000 PE=2 SV=1
Length = 605

Score = 75.5 bits (184), Expect = 1e-12
Identities = 32/73 (43%), Positives = 46/73 (63%)
Frame = -3

Query: 238 EDKQNAEPFVVPTIGAFYMHDDRFXXXXXXXXXXXXXXRKLWEAKDEQRWVHDRFEELKL 59
E+++ EPF VPT GAFYMHDDRF R+LW+++DE++W HD+FEE+
Sbjct: 124 EEQKKKEPFAVPTAGAFYMHDDRFQELDAASNRRMRGGRRLWQSRDERKWGHDKFEEMNT 183

Query: 58 NEENYPPQGGRGR 20
++ Y + RGR
Sbjct: 184 QKQQYDRRTSRGR 196


>tr|Q75KU2|Q75KU2_ORYSJ Putative uncharacterized protein
OJ1014_C08.6 OS=Oryza sativa subsp. japonica
GN=OJ1014_C08.6 PE=4 SV=1
Length = 709

Score = 75.1 bits (183), Expect = 2e-12
Identities = 48/122 (39%), Positives = 64/122 (52%), Gaps = 15/122 (12%)
Frame = -3

Query: 340 EKFSQQRRITDHVAGEAL------------GATELSKGSANKEGLEEDKQNAEPFVVPTI 197
E+F Q R + VA A+ G E +A EG EE K+ +EP+ VPT
Sbjct: 90 EEFEQGRGVAGGVATGAVAAAGEEAGMGMKGEAEGEASAAAAEG-EEGKKGSEPYAVPTA 148

Query: 196 GAFYMHDDRF-XXXXXXXXXXXXXXRKLWEAKDEQRWVHDRFEELKLNE--ENYPPQGGR 26
GAFYMHDDRF R+LW AK++Q WVHDRF+E+ L++ +Y + R
Sbjct: 149 GAFYMHDDRFQEARGHGRQRRMVGDRRLWNAKEDQAWVHDRFDEMNLHDFHNDYTRRRPR 208

Query: 25 GR 20
GR
Sbjct: 209 GR 210