BP916588
Clone id YMU001_000089_D01
Library
Length 389
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000089_D01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GCCGCATGTAATCATCAAGAACATCCATAAGGCTCACCTTCCCAGCTCTCAAATTAATCT
GTGTAATGACAAGTACTCTCTTATTAGAGGACTTTGCCTCCCCTAACATCATGTCTAGTA
GCTTCAGCTTTCCACTTGCTCCTATTCCAAAATCAAGCAGCTCCTTTGCAGATAGATATG
TTAAAGACTCTTGAAATCCTGGTTTGACCAGAAAAGGATGGTTGCAGCACTCACGAAGTT
TCAGAAGAAGTTCTTGTGGAGATGACGCAATATCACCACGCTTACCACGGACAAGAGAGT
CACATTTCTCTATCAGCAACGTACAATATTGCTGCAGCTGAAATGCTGTCATTTTGACAG
GCACCCAAAATTCCATGGGACTAGAAGAC
■■Homology search results ■■ -
sp_hit_id O97159
Definition sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster
Align length 126
Score (bit) 65.5
E-value 8.0e-11
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916588|Adiantum capillus-veneris mRNA, clone:
YMU001_000089_D01.
(389 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein M... 65 8e-11
sp|O14647|CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2... 64 2e-10
sp|P40201|CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1... 64 2e-10
sp|O14646|CHD1_HUMAN Chromodomain-helicase-DNA-binding protein 1... 64 2e-10
sp|A2AJK6|CHD7_MOUSE Chromodomain-helicase-DNA-binding protein 7... 59 1e-08
sp|Q9P2D1|CHD7_HUMAN Chromodomain-helicase-DNA-binding protein 7... 59 1e-08
sp|Q06A37|CHD7_CHICK Chromodomain-helicase-DNA-binding protein 7... 58 2e-08
sp|Q08773|ISW2_YEAST ISWI chromatin-remodeling complex ATPase IS... 57 2e-08
sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3... 57 2e-08
sp|Q3L8U1|CHD9_HUMAN Chromodomain-helicase-DNA-binding protein 9... 57 3e-08
sp|Q8BYH8|CHD9_MOUSE Chromodomain-helicase-DNA-binding protein 9... 57 4e-08
sp|Q9HCK8|CHD8_HUMAN Chromodomain-helicase-DNA-binding protein 8... 56 6e-08
sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3... 55 1e-07
sp|Q6PGB8|SMCA1_MOUSE Probable global transcription activator SN... 54 2e-07
sp|Q7G8Y3|ISW2_ORYSJ Probable chromatin-remodeling complex ATPas... 54 3e-07
sp|P38144|ISW1_YEAST ISWI chromatin-remodeling complex ATPase IS... 54 3e-07
sp|Q8RWY3|ISW2_ARATH Putative chromatin-remodeling complex ATPas... 53 4e-07
sp|P28370|SMCA1_HUMAN Probable global transcription activator SN... 53 5e-07
sp|Q8TD26|CHD6_HUMAN Chromodomain-helicase-DNA-binding protein 6... 53 5e-07
sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3... 53 5e-07
sp|P51531|SMCA2_HUMAN Probable global transcription activator SN... 52 7e-07
sp|Q91ZW3|SMCA5_MOUSE SWI/SNF-related matrix-associated actin-de... 51 2e-06
sp|O60264|SMCA5_HUMAN SWI/SNF-related matrix-associated actin-de... 51 2e-06
sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4... 51 2e-06
sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4... 51 2e-06
sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5... 50 4e-06
sp|Q9NRZ9|HELLS_HUMAN Lymphoid-specific helicase OS=Homo sapiens... 49 6e-06
sp|P51532|SMCA4_HUMAN Probable global transcription activator SN... 49 8e-06
sp|Q3B7N1|CHD1L_BOVIN Chromodomain-helicase-DNA-binding protein ... 49 1e-05
sp|Q60848|HELLS_MOUSE Lymphocyte-specific helicase OS=Mus muscul... 48 1e-05

>sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2
homolog OS=Drosophila melanogaster GN=Mi-2 PE=1 SV=2
Length = 1982

Score = 65.5 bits (158), Expect = 8e-11
Identities = 39/126 (30%), Positives = 70/126 (55%)
Frame = -2

Query: 382 SPMEFWVPVKMTAFQLQQYCTLLIEKCDSLVRGKRGDIASSPQELLLKLRECCNHPFLVK 203
S EF V V+++A Q + Y +L + ++L K G + S +++ L++CCNHP+L
Sbjct: 970 SKSEFIVRVELSAMQKKFYKFILTKNYEAL-NSKSGGGSCSLINIMMDLKKCCNHPYLFP 1028

Query: 202 PGFQESLTYLSAKELLDFGIGASGKLKLLDMMLGEAKSSNKRVLVITQINLRAGKVSLMD 23
+E+ T ++ A+GKL LL ML + K+ N RVL+ +Q+ ++D
Sbjct: 1029 SAAEEATTAAGGLYEINSLTKAAGKLVLLSKMLKQLKAQNHRVLIFSQM------TKMLD 1082

Query: 22 VLDDYM 5
+L+D++
Sbjct: 1083 ILEDFL 1088


>sp|O14647|CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2
OS=Homo sapiens GN=CHD2 PE=1 SV=2
Length = 1828

Score = 64.3 bits (155), Expect = 2e-10
Identities = 40/118 (33%), Positives = 67/118 (56%)
Frame = -2

Query: 358 VKMTAFQLQQYCTLLIEKCDSLVRGKRGDIASSPQELLLKLRECCNHPFLVKPGFQESLT 179
V+M+A Q Q Y +L +L +G RG S ++++L++CCNH +L+KP E
Sbjct: 719 VEMSALQKQYYKWILTRNYKALAKGTRGS-TSGFLNIVMELKKCCNHCYLIKP--PEENE 775

Query: 178 YLSAKELLDFGIGASGKLKLLDMMLGEAKSSNKRVLVITQINLRAGKVSLMDVLDDYM 5
+ +E+L I +SGKL LLD +L + RVL+ +Q+ V ++D+L +Y+
Sbjct: 776 RENGQEILLSLIRSSGKLILLDKLLTRLRERGNRVLIFSQM------VRMLDILAEYL 827


>sp|P40201|CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1
OS=Mus musculus GN=Chd1 PE=1 SV=2
Length = 1711

Score = 64.3 bits (155), Expect = 2e-10
Identities = 37/119 (31%), Positives = 69/119 (57%)
Frame = -2

Query: 358 VKMTAFQLQQYCTLLIEKCDSLVRGKRGDIASSPQELLLKLRECCNHPFLVKPGFQESLT 179
++M+A Q Q Y +L +L +G +G S ++++L++CCNH +L+KP ++
Sbjct: 714 MEMSALQKQYYKWILTRNYKALSKGSKGS-TSGFLNIMMELKKCCNHCYLIKP--PDNNE 770

Query: 178 YLSAKELLDFGIGASGKLKLLDMMLGEAKSSNKRVLVITQINLRAGKVSLMDVLDDYMR 2
+ + +E L I +SGKL LLD +L + RVL+ +Q+ V ++D+L +Y++
Sbjct: 771 FYNKQEALQHLIRSSGKLILLDKLLIRLRERGNRVLIFSQM------VRMLDILAEYLK 823


>sp|O14646|CHD1_HUMAN Chromodomain-helicase-DNA-binding protein 1
OS=Homo sapiens GN=CHD1 PE=1 SV=1
Length = 1709

Score = 64.3 bits (155), Expect = 2e-10
Identities = 37/119 (31%), Positives = 69/119 (57%)
Frame = -2

Query: 358 VKMTAFQLQQYCTLLIEKCDSLVRGKRGDIASSPQELLLKLRECCNHPFLVKPGFQESLT 179
++M+A Q Q Y +L +L +G +G S ++++L++CCNH +L+KP ++
Sbjct: 716 MEMSALQKQYYKWILTRNYKALSKGSKGS-TSGFLNIMMELKKCCNHCYLIKP--PDNNE 772

Query: 178 YLSAKELLDFGIGASGKLKLLDMMLGEAKSSNKRVLVITQINLRAGKVSLMDVLDDYMR 2
+ + +E L I +SGKL LLD +L + RVL+ +Q+ V ++D+L +Y++
Sbjct: 773 FYNKQEALQHLIRSSGKLILLDKLLIRLRERGNRVLIFSQM------VRMLDILAEYLK 825


>sp|A2AJK6|CHD7_MOUSE Chromodomain-helicase-DNA-binding protein 7
OS=Mus musculus GN=Chd7 PE=2 SV=1
Length = 2986

Score = 58.5 bits (140), Expect = 1e-08
Identities = 41/129 (31%), Positives = 69/129 (53%), Gaps = 9/129 (6%)
Frame = -2

Query: 364 VPVKMTAFQLQQYCTLLIEKCDSLVRGKRGDIASSPQEL--LLKLRECCNHPFLVKPG-- 197
+ V++T Q + Y +L + L +G G A+ P L +++LR+CCNHP+L+
Sbjct: 1196 IEVELTNIQKKYYRAILEKNFTFLSKG--GGQANVPNLLNTMMELRKCCNHPYLINGAEE 1253

Query: 196 -----FQESLTYLSAKELLDFGIGASGKLKLLDMMLGEAKSSNKRVLVITQINLRAGKVS 32
F+E+ S L I A+GKL L+D +L + K+ RVL+ +Q+ V
Sbjct: 1254 KILEEFKETHNAESPDFQLQAMIQAAGKLVLIDKLLPKLKAGGHRVLIFSQM------VR 1307

Query: 31 LMDVLDDYM 5
+D+L+DY+
Sbjct: 1308 CLDILEDYL 1316


>sp|Q9P2D1|CHD7_HUMAN Chromodomain-helicase-DNA-binding protein 7
OS=Homo sapiens GN=CHD7 PE=1 SV=3
Length = 2997

Score = 58.5 bits (140), Expect = 1e-08
Identities = 41/129 (31%), Positives = 69/129 (53%), Gaps = 9/129 (6%)
Frame = -2

Query: 364 VPVKMTAFQLQQYCTLLIEKCDSLVRGKRGDIASSPQEL--LLKLRECCNHPFLVKPG-- 197
+ V++T Q + Y +L + L +G G A+ P L +++LR+CCNHP+L+
Sbjct: 1206 IEVELTNIQKKYYRAILEKNFTFLSKG--GGQANVPNLLNTMMELRKCCNHPYLINGAEE 1263

Query: 196 -----FQESLTYLSAKELLDFGIGASGKLKLLDMMLGEAKSSNKRVLVITQINLRAGKVS 32
F+E+ S L I A+GKL L+D +L + K+ RVL+ +Q+ V
Sbjct: 1264 KILEEFKETHNAESPDFQLQAMIQAAGKLVLIDKLLPKLKAGGHRVLIFSQM------VR 1317

Query: 31 LMDVLDDYM 5
+D+L+DY+
Sbjct: 1318 CLDILEDYL 1326


>sp|Q06A37|CHD7_CHICK Chromodomain-helicase-DNA-binding protein 7
OS=Gallus gallus GN=CHD7 PE=2 SV=1
Length = 3011

Score = 57.8 bits (138), Expect = 2e-08
Identities = 41/129 (31%), Positives = 69/129 (53%), Gaps = 9/129 (6%)
Frame = -2

Query: 364 VPVKMTAFQLQQYCTLLIEKCDSLVRGKRGDIASSPQEL--LLKLRECCNHPFLVKPG-- 197
+ V++T Q + Y +L + L +G G A+ P L +++LR+CCNHP+L+
Sbjct: 1207 IEVELTNIQKKYYRAILEKNFAFLSKG--GGQANVPNLLNTMMELRKCCNHPYLINGAEE 1264

Query: 196 -----FQESLTYLSAKELLDFGIGASGKLKLLDMMLGEAKSSNKRVLVITQINLRAGKVS 32
F+E+ S L I A+GKL L+D +L + K+ RVL+ +Q+ V
Sbjct: 1265 KILEEFKETHNADSPDFQLQAMIQAAGKLVLIDKLLPKLKAGGHRVLIFSQM------VR 1318

Query: 31 LMDVLDDYM 5
+D+L+DY+
Sbjct: 1319 CLDILEDYL 1327


>sp|Q08773|ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2
OS=Saccharomyces cerevisiae GN=ISW2 PE=1 SV=1
Length = 1120

Score = 57.4 bits (137), Expect = 2e-08
Identities = 41/121 (33%), Positives = 66/121 (54%), Gaps = 2/121 (1%)
Frame = -2

Query: 364 VPVKMTAFQLQQYCTLLIEKCDSLVRGKRGDIASSPQ--ELLLKLRECCNHPFLVKPGFQ 191
V V MT Q+Q Y +LL + D+ V G G + ++++LR+CCNHP+L + G +
Sbjct: 417 VYVGMTDMQIQWYKSLLEKDIDA-VNGAVGKREGKTRLLNIVMQLRKCCNHPYLFE-GAE 474

Query: 190 ESLTYLSAKELLDFGIGASGKLKLLDMMLGEAKSSNKRVLVITQINLRAGKVSLMDVLDD 11
Y + + L I SGK+ +LD +L K RVL+ +Q++ L+D+L+D
Sbjct: 475 PGPPYTTDEHL----IFNSGKMIILDKLLKRLKEKGSRVLIFSQMS------RLLDILED 524

Query: 10 Y 8
Y
Sbjct: 525 Y 525


>sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3
OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3
Length = 892

Score = 57.4 bits (137), Expect = 2e-08
Identities = 38/123 (30%), Positives = 66/123 (53%)
Frame = -2

Query: 373 EFWVPVKMTAFQLQQYCTLLIEKCDSLVRGKRGDIASSPQELLLKLRECCNHPFLVKPGF 194
EF V V++++ Q + Y +L + +L + K G S +++ LR+CCNHP+L
Sbjct: 507 EFIVRVELSSMQKKFYKHILTKNFKALNQ-KGGGRVCSLLNIMMDLRKCCNHPYLFPSAA 565

Query: 193 QESLTYLSAKELLDFGIGASGKLKLLDMMLGEAKSSNKRVLVITQINLRAGKVSLMDVLD 14
+E+ S + ASGKL LL ML + K+ N RVL+ +Q+ +++VL+
Sbjct: 566 EEATISPSGLYEMSSLTKASGKLDLLSKMLKQLKADNHRVLLFSQM------TKMLNVLE 619

Query: 13 DYM 5
++
Sbjct: 620 HFL 622


>sp|Q3L8U1|CHD9_HUMAN Chromodomain-helicase-DNA-binding protein 9
OS=Homo sapiens GN=CHD9 PE=1 SV=2
Length = 2897

Score = 57.0 bits (136), Expect = 3e-08
Identities = 34/127 (26%), Positives = 67/127 (52%), Gaps = 7/127 (5%)
Frame = -2

Query: 364 VPVKMTAFQLQQYCTLLIEKCDSLVRGKRGDIASSPQELLLKLRECCNHPFLVKPG---- 197
+ V++T Q + Y +L + L +G + +++LR+CCNHP+L+K
Sbjct: 1098 IEVELTNIQKKYYRAILEKNFSFLSKGAGQTNVPNLVNTMMELRKCCNHPYLIKGAEEKI 1157

Query: 196 ---FQESLTYLSAKELLDFGIGASGKLKLLDMMLGEAKSSNKRVLVITQINLRAGKVSLM 26
F+++ ++ L I ++GKL L+D +L + K+ +VL+ +Q+ V +
Sbjct: 1158 LGEFRDTYNPAASDFHLQAMIQSAGKLVLIDKLLPKMKAGGHKVLIFSQM------VRCL 1211

Query: 25 DVLDDYM 5
D+L+DY+
Sbjct: 1212 DILEDYL 1218


tr_hit_id A7NZL8
Definition tr|A7NZL8|A7NZL8_VITVI Chromosome chr6 scaffold_3, whole genome shotgun sequence OS=Vitis vinifera
Align length 130
Score (bit) 101.0
E-value 2.0e-20
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916588|Adiantum capillus-veneris mRNA, clone:
YMU001_000089_D01.
(389 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7NZL8|A7NZL8_VITVI Chromosome chr6 scaffold_3, whole genome ... 101 2e-20
tr|B8AGJ8|B8AGJ8_ORYSI Putative uncharacterized protein OS=Oryza... 81 2e-14
tr|A3A2C4|A3A2C4_ORYSJ Putative uncharacterized protein OS=Oryza... 81 2e-14
tr|Q9M659|Q9M659_ARATH MOM OS=Arabidopsis thaliana PE=2 SV=1 76 1e-12
tr|Q9M658|Q9M658_ARATH MOM OS=Arabidopsis thaliana GN=At1g08060 ... 76 1e-12
tr|A5B3Q2|A5B3Q2_VITVI Putative uncharacterized protein OS=Vitis... 75 2e-12
tr|Q9LN02|Q9LN02_ARATH T6D22.14 OS=Arabidopsis thaliana PE=4 SV=1 73 8e-12
tr|B5YP65|B5YP65_THAPS Predicted protein OS=Thalassiosira pseudo... 73 8e-12
tr|B4M9B0|B4M9B0_DROVI GJ18281 OS=Drosophila virilis GN=GJ18281 ... 72 1e-11
tr|Q8SWV9|Q8SWV9_DROME LD39323p (Fragment) OS=Drosophila melanog... 72 1e-11
tr|Q7KU24|Q7KU24_DROME Chromodomain-helicase-DNA-binding protein... 72 1e-11
tr|Q6NP59|Q6NP59_DROME SD21488p (Fragment) OS=Drosophila melanog... 72 1e-11
tr|Q24376|Q24376_DROME Chromodomain-helicase-DNA-binding protein... 72 1e-11
tr|B4NXB6|B4NXB6_DROYA GE14968 OS=Drosophila yakuba GN=GE14968 P... 72 1e-11
tr|B4MX23|B4MX23_DROWI GK15574 OS=Drosophila willistoni GN=GK155... 72 1e-11
tr|B4KHL3|B4KHL3_DROMO GI10771 OS=Drosophila mojavensis GN=GI107... 72 1e-11
tr|B4JCS5|B4JCS5_DROGR GH10643 OS=Drosophila grimshawi GN=GH1064... 72 1e-11
tr|B3NAN6|B3NAN6_DROER GG24470 OS=Drosophila erecta GN=GG24470 P... 72 1e-11
tr|B3MMA3|B3MMA3_DROAN GF14337 OS=Drosophila ananassae GN=GF1433... 72 1e-11
tr|Q29KH0|Q29KH0_DROPS GA17649 OS=Drosophila pseudoobscura pseud... 71 3e-11
tr|B4GSA0|B4GSA0_DROPE GL26702 OS=Drosophila persimilis GN=GL267... 71 3e-11
tr|Q54UZ8|Q54UZ8_DICDI Myb domain-containing protein OS=Dictyost... 69 9e-11
tr|B4ML97|B4ML97_DROWI GK17504 OS=Drosophila willistoni GN=GK175... 69 2e-10
tr|A9X4T1|A9X4T1_BOMMO CHD1 OS=Bombyx mori GN=CHD1 PE=2 SV=1 68 3e-10
tr|A2FI37|A2FI37_TRIVA SNF2 family N-terminal domain containing ... 67 3e-10
tr|B8B194|B8B194_ORYSI Putative uncharacterized protein OS=Oryza... 67 4e-10
tr|A3B7I8|A3B7I8_ORYSJ Putative uncharacterized protein OS=Oryza... 67 4e-10
tr|Q4SS19|Q4SS19_TETNG Chromosome undetermined SCAF14482, whole ... 67 6e-10
tr|B4PFW6|B4PFW6_DROYA GE22457 OS=Drosophila yakuba GN=Dyak\GE22... 67 6e-10
tr|B5DQA0|B5DQA0_DROPS GA23929 OS=Drosophila pseudoobscura pseud... 66 8e-10

>tr|A7NZL8|A7NZL8_VITVI Chromosome chr6 scaffold_3, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00024563001
PE=4 SV=1
Length = 628

Score = 101 bits (252), Expect = 2e-20
Identities = 53/130 (40%), Positives = 81/130 (62%), Gaps = 1/130 (0%)
Frame = -2

Query: 388 SSSPMEFWVPVKMTAFQLQQYCTLLIEKCDSLVRGKRGDIASSPQELLLKLRECCNHPFL 209
SS +E+WVP+ ++ QL+QYC L+ SL + D + +++L+ R+CC+HP++
Sbjct: 77 SSRFVEYWVPIPLSNVQLEQYCGTLLSNTISLCSCSKNDPVGALRDVLISTRKCCDHPYI 136

Query: 208 VKPGFQESLTY-LSAKELLDFGIGASGKLKLLDMMLGEAKSSNKRVLVITQINLRAGKVS 32
V Q LT L E LD GI ASGKL+LLD M+ E K+ RVL++ Q +G+ S
Sbjct: 137 VDLSLQSFLTKGLPEIEYLDVGINASGKLQLLDRMISEIKNRGLRVLILFQSIGGSGRDS 196

Query: 31 LMDVLDDYMR 2
+ D+LDD++R
Sbjct: 197 IGDILDDFLR 206


>tr|B8AGJ8|B8AGJ8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_05543 PE=4 SV=1
Length = 2670

Score = 81.3 bits (199), Expect = 2e-14
Identities = 46/129 (35%), Positives = 76/129 (58%), Gaps = 1/129 (0%)
Frame = -2

Query: 388 SSSPMEFWVPVKMTAFQLQQYCTLLIEKCDSLVRGKRGDIASSPQELLLKLRECCNHPFL 209
SS +E+WVP ++ QL+ YC++L+ K L D + ++ L L++CC+HP++
Sbjct: 757 SSKFLEYWVPSCISQPQLEMYCSILLSKSSVLRSEMETDSVGALHDIYLSLKKCCDHPYI 816

Query: 208 VKPGFQESLTYLS-AKELLDFGIGASGKLKLLDMMLGEAKSSNKRVLVITQINLRAGKVS 32
V + SL+ S E +D + ASGKL +LD ML E K + RV+++ Q + RAG
Sbjct: 817 VNEFLRSSLSNNSNVTENIDTVVHASGKLLVLDKMLNEIKKKSLRVILLFQSD-RAGGNK 875

Query: 31 LMDVLDDYM 5
+ ++L+D M
Sbjct: 876 MGNILEDLM 884


>tr|A3A2C4|A3A2C4_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_004946 PE=4 SV=1
Length = 2604

Score = 81.3 bits (199), Expect = 2e-14
Identities = 46/129 (35%), Positives = 76/129 (58%), Gaps = 1/129 (0%)
Frame = -2

Query: 388 SSSPMEFWVPVKMTAFQLQQYCTLLIEKCDSLVRGKRGDIASSPQELLLKLRECCNHPFL 209
SS +E+WVP ++ QL+ YC++L+ K L D + ++ L L++CC+HP++
Sbjct: 699 SSKFLEYWVPSCISQPQLEMYCSILLSKSSVLRSEMETDSVGALHDIYLSLKKCCDHPYI 758

Query: 208 VKPGFQESLTYLS-AKELLDFGIGASGKLKLLDMMLGEAKSSNKRVLVITQINLRAGKVS 32
V + SL+ S E +D + ASGKL +LD ML E K + RV+++ Q + RAG
Sbjct: 759 VNEFLRSSLSNNSNVTENIDTVVHASGKLLVLDKMLNEIKKKSLRVILLFQSD-RAGGNK 817

Query: 31 LMDVLDDYM 5
+ ++L+D M
Sbjct: 818 MGNILEDLM 826


>tr|Q9M659|Q9M659_ARATH MOM OS=Arabidopsis thaliana PE=2 SV=1
Length = 2001

Score = 75.9 bits (185), Expect = 1e-12
Identities = 46/129 (35%), Positives = 73/129 (56%), Gaps = 1/129 (0%)
Frame = -2

Query: 388 SSSPMEFWVPVKMTAFQLQQYCTLLIEKCDSLVRGKRGDIASSPQELLLKLRECCNHPFL 209
SS E+WVPV+++ QL+QYC L K SL + D+ + +E L +R+ C+HP++
Sbjct: 474 SSVYPEYWVPVQLSDVQLEQYCQTLFSKSLSLSSLSKIDLGAL-EETLNSVRKTCDHPYV 532

Query: 208 VKPGFQESLTY-LSAKELLDFGIGASGKLKLLDMMLGEAKSSNKRVLVITQINLRAGKVS 32
+ ++ LT L E+LD I ASGKL LLD ML K + + +V Q +
Sbjct: 533 MDASLKQLLTKNLELHEILDVEIKASGKLHLLDKMLTHIKKNGLKAVVFYQATQTPEGLL 592

Query: 31 LMDVLDDYM 5
L ++L+D++
Sbjct: 593 LGNILEDFV 601


>tr|Q9M658|Q9M658_ARATH MOM OS=Arabidopsis thaliana GN=At1g08060
PE=4 SV=1
Length = 2001

Score = 75.9 bits (185), Expect = 1e-12
Identities = 46/129 (35%), Positives = 73/129 (56%), Gaps = 1/129 (0%)
Frame = -2

Query: 388 SSSPMEFWVPVKMTAFQLQQYCTLLIEKCDSLVRGKRGDIASSPQELLLKLRECCNHPFL 209
SS E+WVPV+++ QL+QYC L K SL + D+ + +E L +R+ C+HP++
Sbjct: 474 SSVYPEYWVPVQLSDVQLEQYCQTLFSKSLSLSSLSKIDLGAL-EETLNSVRKTCDHPYV 532

Query: 208 VKPGFQESLTY-LSAKELLDFGIGASGKLKLLDMMLGEAKSSNKRVLVITQINLRAGKVS 32
+ ++ LT L E+LD I ASGKL LLD ML K + + +V Q +
Sbjct: 533 MDASLKQLLTKNLELHEILDVEIKASGKLHLLDKMLTHIKKNGLKAVVFYQATQTPEGLL 592

Query: 31 LMDVLDDYM 5
L ++L+D++
Sbjct: 593 LGNILEDFV 601


>tr|A5B3Q2|A5B3Q2_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_044023 PE=4 SV=1
Length = 431

Score = 74.7 bits (182), Expect = 2e-12
Identities = 40/100 (40%), Positives = 59/100 (59%), Gaps = 1/100 (1%)
Frame = -2

Query: 388 SSSPMEFWVPVKMTAFQLQQYCTLLIEKCDSLVRGKRGDIASSPQELLLKLRECCNHPFL 209
SS +E+WVP+ ++ QL+QY L+ SL + D + +++L+ +CC+HPF+
Sbjct: 86 SSRFVEYWVPIPLSNVQLEQYRGTLLSNTTSLCSCSKNDPVGALRDVLISTPKCCDHPFI 145

Query: 208 VKPGFQESLTY-LSAKELLDFGIGASGKLKLLDMMLGEAK 92
V Q LT L E LD GI A+GKL+LLD M+ E K
Sbjct: 146 VDLSLQSFLTKGLPEIEYLDVGIDATGKLQLLDRMISEIK 185


>tr|Q9LN02|Q9LN02_ARATH T6D22.14 OS=Arabidopsis thaliana PE=4 SV=1
Length = 2254

Score = 72.8 bits (177), Expect = 8e-12
Identities = 46/130 (35%), Positives = 75/130 (57%), Gaps = 2/130 (1%)
Frame = -2

Query: 388 SSSPMEFWVPVKMTAFQLQQYCTLLIEKCDSLVRGKRGDIASSPQELLLKLRECCNHPFL 209
SS E+WVPV+++ QL+QYC L K SL + D+ + +E L +R+ C+HP++
Sbjct: 706 SSVYPEYWVPVQLSDVQLEQYCQTLFSKSLSLSSLSKIDLGAL-EETLNSVRKTCDHPYV 764

Query: 208 VKPGFQESLT-YLSAKELLDFGIGASGKLKLLDMMLGEAKSSNKRVLVITQINLRAGKVS 32
+ ++ LT L E+LD I ASGKL LLD ML K + + +V Q + +
Sbjct: 765 MDASLKQLLTKNLELHEILDVEIKASGKLHLLDKMLTHIKKNGLKAVVFYQQATQTPEGL 824

Query: 31 LM-DVLDDYM 5
L+ ++L+D++
Sbjct: 825 LLGNILEDFV 834


>tr|B5YP65|B5YP65_THAPS Predicted protein OS=Thalassiosira
pseudonana CCMP1335 GN=THAPS_35501 PE=4 SV=1
Length = 338

Score = 72.8 bits (177), Expect = 8e-12
Identities = 42/123 (34%), Positives = 66/123 (53%)
Frame = -2

Query: 373 EFWVPVKMTAFQLQQYCTLLIEKCDSLVRGKRGDIASSPQELLLKLRECCNHPFLVKPGF 194
E + V++T Q Q Y L + L RGK+ S L ++LR+CCNHPFL+
Sbjct: 121 ETLIEVELTVLQKQYYRALYEKNLKFLHRGKKPLDGPSINNLAMQLRKCCNHPFLLTGVE 180

Query: 193 QESLTYLSAKELLDFGIGASGKLKLLDMMLGEAKSSNKRVLVITQINLRAGKVSLMDVLD 14
E KE++D + ASGKL LLD +L K+ R+L+ +Q + ++D+++
Sbjct: 181 SEVRLQQPNKEIVDLMVEASGKLVLLDKLLPRLKADGHRILLFSQFKI------MLDLIE 234

Query: 13 DYM 5
DY+
Sbjct: 235 DYL 237


>tr|B4M9B0|B4M9B0_DROVI GJ18281 OS=Drosophila virilis GN=GJ18281 PE=4
SV=1
Length = 1924

Score = 72.4 bits (176), Expect = 1e-11
Identities = 45/119 (37%), Positives = 70/119 (58%)
Frame = -2

Query: 358 VKMTAFQLQQYCTLLIEKCDSLVRGKRGDIASSPQELLLKLRECCNHPFLVKPGFQESLT 179
V+MT+ Q Q Y +L + D+L +GKRG S+ ++++L++CCNH L++P E L
Sbjct: 788 VEMTSLQKQYYKWILTKNFDALRKGKRGS-TSTFLNIVIELKKCCNHAALIRPSEFE-LF 845

Query: 178 YLSAKELLDFGIGASGKLKLLDMMLGEAKSSNKRVLVITQINLRAGKVSLMDVLDDYMR 2
L E L + SGKL LLD +L K + RVL+ +Q+ V ++DVL DY++
Sbjct: 846 GLQQDEALQMLLKGSGKLVLLDKLLCRLKETGHRVLIFSQM------VRMLDVLADYLQ 898


>tr|Q8SWV9|Q8SWV9_DROME LD39323p (Fragment) OS=Drosophila
melanogaster GN=Chd1 PE=2 SV=1
Length = 1101

Score = 72.0 bits (175), Expect = 1e-11
Identities = 44/119 (36%), Positives = 70/119 (58%)
Frame = -2

Query: 358 VKMTAFQLQQYCTLLIEKCDSLVRGKRGDIASSPQELLLKLRECCNHPFLVKPGFQESLT 179
V+MT+ Q Q Y +L + D+L +GKRG S+ ++++L++CCNH L++P + L
Sbjct: 231 VEMTSLQKQYYKWILTKNFDALRKGKRGS-TSTFLNIVIELKKCCNHAALIRPS-EFELM 288

Query: 178 YLSAKELLDFGIGASGKLKLLDMMLGEAKSSNKRVLVITQINLRAGKVSLMDVLDDYMR 2
L E L + SGKL LLD +L K + RVL+ +Q+ V ++DVL DY++
Sbjct: 289 GLQQDEALQTLLKGSGKLVLLDKLLCRLKETGHRVLIFSQM------VRMLDVLADYLQ 341