BP916611
Clone id YMU001_000089_E12
Library
Length 506
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000089_E12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GGTCATCATCAACAATATTACCCCCTCCTCTGTCCCCTCTTCTTTCATATGCCTTTTTCT
CAAATTCTGCCTCATGTGCATTTTTCTGGAGTTCTGCCTCTAAGCTTCCTTTCCCCTCCG
CAGGTATACTCTTGCTTTCCTCATTCATAGGCCGAAGGTTAGCTTGGACTGTGCTCCCAC
CTTTCTCTGCCTCTTGAACATCTTCCGTATTTTGAATATTATCATTAGCTTGTTCATTGA
TGCTTTGCACCAAATCCACAAATGCAGATGCAGGGAGATCAAAAGACCGCGCTTTCACAG
ACGCATCCCCCTGCACTGGCAGGTTCACGCTTGGGTCACTACCAACTGCTCCTTCCATTT
CTGATTCAGTGCTTTCCCACTTTTGTCTTGTTTGCAGGTTTTGAGACATAAGGCTATCCT
CTAATTCAACACCACCTTCTCCTTTTCTTAGCTTACCCTCAAAATCAGTCTTGTGGGCGC
CAGAATCAGGACTAACTTGCGGACCT
■■Homology search results ■■ -
sp_hit_id Q2UC04
Definition sp|Q2UC04|NOP58_ASPOR Nucleolar protein nop58 OS=Aspergillus oryzae
Align length 136
Score (bit) 36.2
E-value 0.083
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916611|Adiantum capillus-veneris mRNA, clone:
YMU001_000089_E12.
(492 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q2UC04|NOP58_ASPOR Nucleolar protein nop58 OS=Aspergillus ory... 36 0.083
sp|Q4WYK9|NOP58_ASPFU Nucleolar protein nop58 OS=Aspergillus fum... 36 0.083
sp|P13475|3F_DICDI Protein 3F OS=Dictyostelium discoideum GN=psp... 35 0.18
sp|A1D688|NOP58_NEOFI Nucleolar protein nop58 OS=Neosartorya fis... 35 0.24
sp|Q1E1Q5|NOP58_COCIM Nucleolar protein NOP58 OS=Coccidioides im... 34 0.31
sp|Q9QZM6|NCKX1_RAT Sodium/potassium/calcium exchanger 1 OS=Ratt... 34 0.31
sp|A1CL70|NOP58_ASPCL Nucleolar protein nop58 OS=Aspergillus cla... 34 0.41
sp|Q6ZNL6|FGD5_HUMAN FYVE, RhoGEF and PH domain-containing prote... 34 0.41
sp|Q9I969|TXLNB_CHICK Beta-taxilin OS=Gallus gallus GN=TXLNB PE=... 33 0.54
sp|Q0CQH1|NOP58_ASPTN Nucleolar protein nop58 OS=Aspergillus ter... 33 0.54
sp|Q9GRW7|NONA_DROVI Protein no-on-transient A OS=Drosophila vir... 33 0.92
sp|Q9GRX4|NONA_DROLR Protein no-on-transient A OS=Drosophila lit... 33 0.92
sp|Q31IN8|RF1_THICR Peptide chain release factor 1 OS=Thiomicros... 32 1.2
sp|P35616|NFL_XENLA Neurofilament light polypeptide OS=Xenopus l... 32 1.2
sp|B0Z503|YCF2_OENBI Protein ycf2 OS=Oenothera biennis GN=ycf2-A... 32 1.6
sp|O36020|MU126_SCHPO Meiotically up-regulated gene 126 protein ... 32 1.6
sp|Q9Z331|K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus mu... 32 1.6
sp|P50446|K2C6A_MOUSE Keratin, type II cytoskeletal 6A OS=Mus mu... 32 1.6
sp|Q01042|IE68_SHV21 Immediate-early protein OS=Saimiriine herpe... 32 1.6
sp|Q61KR9|CALR_CAEBR Calreticulin OS=Caenorhabditis briggsae GN=... 32 1.6
sp|P31568|YCF2_OENPI Protein ycf2 (Fragment) OS=Oenothera picens... 32 2.0
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding prote... 32 2.0
sp|Q4VA55|MUML1_MOUSE MUM1-like protein 1 OS=Mus musculus GN=Mum... 32 2.0
sp|Q4R5E3|LMBD1_MACFA Probable lysosomal cobalamin transporter O... 32 2.0
sp|Q9NUN5|LMBD1_HUMAN Probable lysosomal cobalamin transporter O... 32 2.0
sp|Q58362|PFDA1_METJA Prefoldin subunit alpha 1 OS=Methanocaldoc... 31 2.7
sp|Q04851|OSPA4_BORBU Outer surface protein A OS=Borrelia burgdo... 31 2.7
sp|P07197|NFM_HUMAN Neurofilament medium polypeptide OS=Homo sap... 31 2.7
sp|Q5A6Q7|EAF7_CANAL Chromatin modification-related protein EAF7... 31 2.7
sp|P27798|CALR_CAEEL Calreticulin OS=Caenorhabditis elegans GN=c... 31 2.7

>sp|Q2UC04|NOP58_ASPOR Nucleolar protein nop58 OS=Aspergillus oryzae
GN=nop58 PE=3 SV=1
Length = 578

Score = 36.2 bits (82), Expect = 0.083
Identities = 34/136 (25%), Positives = 63/136 (46%), Gaps = 4/136 (2%)
Frame = -2

Query: 407 EDSLMSQNLQTRQKWESTESEMEGAVGSDPSVNLPVQGDASVKARSFDL-PASAFVDLVQ 231
E+ + ++ R E + MEG V + G + +A+ F+L A +
Sbjct: 387 EEDKAALGIEARFNLERKLAGMEGKPLKPRGVTIAPNGTPA-QAKKFELNEARKYNADAD 445

Query: 230 SINEQANDNIQN--TEDVQEAEKGGSTVQANLRPMNE-ESKSIPAEGKGSLEAELQKNAH 60
+++E ++ Q E+VQ+ E + A +E E +S + K S +A+L+K A
Sbjct: 446 AVDEPSSAKKQKKLVEEVQDTEMADADSDAEADSSDESEEESSKKKSKKSKDADLEKMAE 505

Query: 59 EAEFEKKAYERRGDRG 12
+A K Y+R+ +RG
Sbjct: 506 KAGLSLKRYKRKLERG 521


>sp|Q4WYK9|NOP58_ASPFU Nucleolar protein nop58 OS=Aspergillus
fumigatus GN=nop58 PE=3 SV=1
Length = 591

Score = 36.2 bits (82), Expect = 0.083
Identities = 27/94 (28%), Positives = 42/94 (44%)
Frame = -2

Query: 293 DASVKARSFDLPASAFVDLVQSINEQANDNIQNTEDVQEAEKGGSTVQANLRPMNEESKS 114
+A A + D PAS + + E+ +D D E K T + +EE S
Sbjct: 441 NADADALTGDQPASK---KDKKLIEEVSDEEMADADSNEEPKANGTKDDDSSDESEEESS 497

Query: 113 IPAEGKGSLEAELQKNAHEAEFEKKAYERRGDRG 12
+ K +AEL+K A +A K Y+R+ +RG
Sbjct: 498 KKHKSKKGKDAELEKMAEKAGLSVKRYKRKLERG 531


>sp|P13475|3F_DICDI Protein 3F OS=Dictyostelium discoideum GN=pspG
PE=2 SV=2
Length = 246

Score = 35.0 bits (79), Expect = 0.18
Identities = 24/112 (21%), Positives = 46/112 (41%)
Frame = -2

Query: 410 LEDSLMSQNLQTRQKWESTESEMEGAVGSDPSVNLPVQGDASVKARSFDLPASAFVDLVQ 231
L+D+ + N + QK +T+S +G+ SD P +S AS D Q
Sbjct: 120 LKDNADAANTENAQKSPNTQSTQKGSPKSDAKEASPKTDAKEASPKSDAKEASPKTDTKQ 179

Query: 230 SINEQANDNIQNTEDVQEAEKGGSTVQANLRPMNEESKSIPAEGKGSLEAEL 75
+ + + + ++ + +AN NEE++ + +L+A L
Sbjct: 180 GSSPKTDTKSSTQKPSSSSDSSKAKAEANTAANNEEAEHVEKGASNTLKASL 231


>sp|A1D688|NOP58_NEOFI Nucleolar protein nop58 OS=Neosartorya
fischeri (strain ATCC 1020 / DSM 3700 / NRRL 181)
GN=nop58 PE=3 SV=1
Length = 591

Score = 34.7 bits (78), Expect = 0.24
Identities = 26/94 (27%), Positives = 41/94 (43%)
Frame = -2

Query: 293 DASVKARSFDLPASAFVDLVQSINEQANDNIQNTEDVQEAEKGGSTVQANLRPMNEESKS 114
+A A + D PAS + + E+ +D D E K T + +EE S
Sbjct: 441 NADADALTGDQPASK---KDKKLIEEVSDEEMADADSDEEPKANGTKDDDSSDESEEESS 497

Query: 113 IPAEGKGSLEAELQKNAHEAEFEKKAYERRGDRG 12
+ K + EL+K A +A K Y+R+ +RG
Sbjct: 498 KKHKSKKGKDTELEKMAEKAGLSVKRYKRKLERG 531


>sp|Q1E1Q5|NOP58_COCIM Nucleolar protein NOP58 OS=Coccidioides
immitis GN=NOP58 PE=3 SV=1
Length = 607

Score = 34.3 bits (77), Expect = 0.31
Identities = 30/130 (23%), Positives = 62/130 (47%), Gaps = 6/130 (4%)
Frame = -2

Query: 383 LQTRQKWESTES-----EMEGAVGSDPSVNLPVQGDASVKARSFDLPASAFVDLVQSI-N 222
++ +KW+ E+ + +G G +P+ V + + LV+ I +
Sbjct: 432 IEQPKKWDIKEARKHNPDADGLTGDEPAATENVSKKSKKDKK-----------LVEEIKD 480

Query: 221 EQANDNIQNTEDVQEAEKGGSTVQANLRPMNEESKSIPAEGKGSLEAELQKNAHEAEFEK 42
E+ D ++ E+ + +E S + + +ESK+ ++GK S EA++++ A +A
Sbjct: 481 EEMKDAPESEEEEEASEAEESEEEKPKKSKKKESKT--SKGKDSDEAKIEELAEKAGLSV 538

Query: 41 KAYERRGDRG 12
K Y R+ +RG
Sbjct: 539 KRYLRKLERG 548


>sp|Q9QZM6|NCKX1_RAT Sodium/potassium/calcium exchanger 1 OS=Rattus
norvegicus GN=Slc24a1 PE=2 SV=1
Length = 1181

Score = 34.3 bits (77), Expect = 0.31
Identities = 34/153 (22%), Positives = 59/153 (38%), Gaps = 1/153 (0%)
Frame = -2

Query: 473 DSGAHKTDFEGKL-RKGEGGVELEDSLMSQNLQTRQKWESTESEMEGAVGSDPSVNLPVQ 297
+ G +T+ EGK +GE E ++ + +T+ K E E E E G D +
Sbjct: 725 EEGERETEAEGKKDEEGETEAERKEDGQEEETETKGK-EKQEGETESE-GKDEQ-----E 777

Query: 296 GDASVKARSFDLPASAFVDLVQSINEQANDNIQNTEDVQEAEKGGSTVQANLRPMNEESK 117
G+ + + D + + + + + TED QE E E K
Sbjct: 778 GETEAEGKEADHEGETEAE-GKEVEHEGETEAEGTEDEQEGET------------EAEGK 824

Query: 116 SIPAEGKGSLEAELQKNAHEAEFEKKAYERRGD 18
+ EG+ E + ++ E E E+K G+
Sbjct: 825 EVEQEGETEAEGKEVEHEVETEAERKETNHEGE 857


>sp|A1CL70|NOP58_ASPCL Nucleolar protein nop58 OS=Aspergillus
clavatus GN=nop58 PE=3 SV=1
Length = 592

Score = 33.9 bits (76), Expect = 0.41
Identities = 27/94 (28%), Positives = 40/94 (42%)
Frame = -2

Query: 293 DASVKARSFDLPASAFVDLVQSINEQANDNIQNTEDVQEAEKGGSTVQANLRPMNEESKS 114
+A A S D P S + + E+ +D D E T + +EE KS
Sbjct: 441 NADADALSSDEPKSK---KDKKLIEEVSDEEMADADSDEEPAANGTKDDDSSDDSEEEKS 497

Query: 113 IPAEGKGSLEAELQKNAHEAEFEKKAYERRGDRG 12
+ K +AEL+K A A K Y+R+ +RG
Sbjct: 498 KKHKSKKGKDAELEKLAERAGLSLKRYKRKLERG 531


>sp|Q6ZNL6|FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5
OS=Homo sapiens GN=FGD5 PE=2 SV=2
Length = 1462

Score = 33.9 bits (76), Expect = 0.41
Identities = 29/110 (26%), Positives = 51/110 (46%), Gaps = 2/110 (1%)
Frame = -2

Query: 362 ESTESEMEGAVGSDPSVNLPVQGDASVKARSFDLPAS--AFVDLVQSINEQANDNIQNTE 189
E SE E + DPSV V+G + + +L +S A+V+++Q +N + +
Sbjct: 867 EQRSSEEEDSASRDPSVTHKVEGQSRALVIAQELLSSEKAYVEMLQHLNLDFHGAVMRAL 926

Query: 188 DVQEAEKGGSTVQANLRPMNEESKSIPAEGKGSLEAELQKNAHEAEFEKK 39
D + E + + LR E +I +G LE EL++ E ++K
Sbjct: 927 DDMDHEGRDTLAREELRQGLSELPAIHDLHQGILE-ELEERLSNWESQQK 975


>sp|Q9I969|TXLNB_CHICK Beta-taxilin OS=Gallus gallus GN=TXLNB PE=2
SV=1
Length = 676

Score = 33.5 bits (75), Expect = 0.54
Identities = 36/141 (25%), Positives = 54/141 (38%), Gaps = 16/141 (11%)
Frame = -2

Query: 395 MSQNLQTRQKWESTESEMEGAVGSDPSVNLPVQGDASVKARSFDLPASAFVDLVQSINEQ 216
M + T ++ + T S + G + +PV S ++ P A D+ + +N Q
Sbjct: 1 MENDQFTEKQQQVTTSPTQDNQGQSKAEPVPVSQPLSPTNQTSAQPEMATCDISEELNRQ 60

Query: 215 ANDNIQN---------------TEDVQEAEKGGSTVQANLRPMNEES-KSIPAEGKGSLE 84
D I+ D E E GS A +NEES K PA G S
Sbjct: 61 LEDIIKTYGSAASLVEKEGTTAETDKPEKEDVGSMEDAECEDVNEESEKDKPAPGDAS-R 119

Query: 83 AELQKNAHEAEFEKKAYERRG 21
A+ + E + EKK + G
Sbjct: 120 AKEPSASKEQKLEKKILKGLG 140


>sp|Q0CQH1|NOP58_ASPTN Nucleolar protein nop58 OS=Aspergillus
terreus (strain NIH 2624) GN=nop58 PE=3 SV=1
Length = 577

Score = 33.5 bits (75), Expect = 0.54
Identities = 26/90 (28%), Positives = 41/90 (45%)
Frame = -2

Query: 281 KARSFDLPASAFVDLVQSINEQANDNIQNTEDVQEAEKGGSTVQANLRPMNEESKSIPAE 102
+AR ++ A A VD + A + E+VQ+ E + ++ EES +
Sbjct: 436 EARKYNADADAMVD---DEPKSAKKQKKLVEEVQDEEMADANGASDSDSSEEESSKKSKK 492

Query: 101 GKGSLEAELQKNAHEAEFEKKAYERRGDRG 12
GK LE K A +A K Y+R+ +RG
Sbjct: 493 GKSDLE----KMAEKAGLSVKRYQRKLERG 518


tr_hit_id A4S8H1
Definition tr|A4S8H1|A4S8H1_OSTLU Predicted protein OS=Ostreococcus lucimarinus (strain CCE9901)
Align length 123
Score (bit) 39.7
E-value 0.076
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916611|Adiantum capillus-veneris mRNA, clone:
YMU001_000089_E12.
(492 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A4S8H1|A4S8H1_OSTLU Predicted protein OS=Ostreococcus lucimar... 40 0.076
tr|A8J3V2|A8J3V2_CHLRE Predicted protein OS=Chlamydomonas reinha... 38 0.22
tr|B7U346|B7U346_PHOVI Neurofilament medium tail domain (Fragmen... 37 0.38
tr|Q4PE15|Q4PE15_USTMA Putative uncharacterized protein OS=Ustil... 37 0.38
tr|Q2GRH8|Q2GRH8_CHAGB Putative uncharacterized protein OS=Chaet... 37 0.38
tr|Q4RP46|Q4RP46_TETNG Chromosome 1 SCAF15008, whole genome shot... 37 0.64
tr|A8WXR3|A8WXR3_CAEBR Putative uncharacterized protein OS=Caeno... 37 0.64
tr|B2VQS7|B2VQS7_PYRTR Putative uncharacterized protein OS=Pyren... 37 0.64
tr|Q9CGA2|Q9CGA2_LACLA Putative uncharacterized protein ymbJ OS=... 36 0.84
tr|B4K453|B4K453_DROGR GH23407 OS=Drosophila grimshawi GN=GH2340... 36 0.84
tr|B0XWG2|B0XWG2_ASPFC Nucleolar protein nop5 OS=Aspergillus fum... 36 0.84
tr|Q8LKK6|Q8LKK6_9STRA Putative uncharacterized protein OS=Phyto... 36 1.1
tr|Q9U0K4|Q9U0K4_PLAF7 Putative uncharacterized protein PFD0405w... 36 1.1
tr|Q0UNG4|Q0UNG4_PHANO Putative uncharacterized protein OS=Phaeo... 36 1.1
tr|Q4FU25|Q4FU25_PSYA2 Putative uncharacterized protein OS=Psych... 35 1.4
tr|Q3LBI8|Q3LBI8_9MOLU Putative uncharacterized protein (Fragmen... 35 1.4
tr|B3L046|B3L046_PLAKH DNA polymerase alpha, putative OS=Plasmod... 35 1.4
tr|A4I5B0|A4I5B0_LEIIN Putative uncharacterized protein OS=Leish... 35 1.4
tr|Q4Y5Q9|Q4Y5Q9_PLACH Putative uncharacterized protein (Fragmen... 35 1.9
tr|B8N507|B8N507_ASPFL Nucleolar protein nop5 OS=Aspergillus fla... 35 1.9
tr|A3QIZ1|A3QIZ1_SHELP GAF modulated sigma54 specific transcript... 35 2.4
tr|A4IUK0|A4IUK0_YERRU Putative uncharacterized protein OS=Yersi... 35 2.4
tr|Q7RH28|Q7RH28_PLAYO Mature-parasite-infected erythrocyte surf... 35 2.4
tr|A2ERV4|A2ERV4_TRIVA Putative uncharacterized protein OS=Trich... 35 2.4
tr|A1CDN4|A1CDN4_ASPCL RSC complex subunit (RSC8), putative OS=A... 35 2.4
tr|Q56PC3|Q56PC3_MACMU RPGR (Fragment) OS=Macaca mulatta PE=2 SV=1 34 3.2
tr|Q55G51|Q55G51_DICDI Putative uncharacterized protein OS=Dicty... 34 3.2
tr|A0DLR2|A0DLR2_PARTE Chromosome undetermined scaffold_556, who... 34 3.2
tr|Q2H063|Q2H063_CHAGB Putative uncharacterized protein OS=Chaet... 34 3.2
tr|Q0V3K3|Q0V3K3_PHANO Putative uncharacterized protein OS=Phaeo... 34 3.2

>tr|A4S8H1|A4S8H1_OSTLU Predicted protein OS=Ostreococcus
lucimarinus (strain CCE9901) GN=OSTLU_27849 PE=4 SV=1
Length = 270

Score = 39.7 bits (91), Expect = 0.076
Identities = 34/123 (27%), Positives = 56/123 (45%), Gaps = 4/123 (3%)
Frame = -2

Query: 362 ESTESEMEGAVGSDPSVNLPVQGDASVKAR---SFDLPASAFVDLVQSINE-QANDNIQN 195
ES +SE E D V A+ AR + D D +S +E ++ D+ Q+
Sbjct: 138 ESDDSESESDGEEDMMVKAKAMAKAAAAARRAEASDEDEDEGEDESESESESESEDSEQD 197

Query: 194 TEDVQEAEKGGSTVQANLRPMNEESKSIPAEGKGSLEAELQKNAHEAEFEKKAYERRGDR 15
D +E+E ++ + +++S ++P + + NA EA+FE RRG R
Sbjct: 198 DSDEEESESDDASDDDSSDDSSDDSDALPGSKR-------KANAKEAKFEDARDARRGGR 250

Query: 14 GGG 6
GGG
Sbjct: 251 GGG 253


>tr|A8J3V2|A8J3V2_CHLRE Predicted protein OS=Chlamydomonas
reinhardtii GN=CHLREDRAFT_174609 PE=4 SV=1
Length = 1479

Score = 38.1 bits (87), Expect = 0.22
Identities = 39/143 (27%), Positives = 56/143 (39%)
Frame = -2

Query: 473 DSGAHKTDFEGKLRKGEGGVELEDSLMSQNLQTRQKWESTESEMEGAVGSDPSVNLPVQG 294
D AHK G + EGG E E+ L++ E+ VGS + P G
Sbjct: 528 DGAAHK----GAEAEAEGGEEAEEQLLAAE---------AEAAAAVVVGSGSAATTPTAG 574

Query: 293 DASVKARSFDLPASAFVDLVQSINEQANDNIQNTEDVQEAEKGGSTVQANLRPMNEESKS 114
+F P +A V A + +T D + A GG V RP+ +S +
Sbjct: 575 SRPADELAFAAPEAAAAAAVAVAATAAVAS--STADAEGAAAGGGGV----RPLQHQSST 628

Query: 113 IPAEGKGSLEAELQKNAHEAEFE 45
+ G + E ELQ A E E +
Sbjct: 629 ASSSGFDAAEVELQV-ADEVELQ 650


>tr|B7U346|B7U346_PHOVI Neurofilament medium tail domain (Fragment)
OS=Phoca vitulina GN=nefm PE=4 SV=1
Length = 455

Score = 37.4 bits (85), Expect = 0.38
Identities = 37/136 (27%), Positives = 58/136 (42%), Gaps = 6/136 (4%)
Frame = -2

Query: 413 ELEDSL--MSQNLQTRQKWESTESEMEGAVGSDPSVNLPVQGDASVKARSFDLPASAFVD 240
E+ED+L +++ L K E E E EG + + VKA + +L
Sbjct: 67 EMEDALTAIAEELAVSMK-EEKEEEAEGKEEEPAEEEVVATKKSPVKAAAPELKEE---- 121

Query: 239 LVQSINEQANDNIQNTEDVQEAEKGGSTVQANLRPMNEESKSIPAEG----KGSLEAELQ 72
E + + E+ +E E+G + QA +E S EG +G EAE +
Sbjct: 122 -----EEGEKEEEEGQEEEEEEEEGAKSDQAEEGGSEKEGSSEKEEGEQEEEGETEAEGE 176

Query: 71 KNAHEAEFEKKAYERR 24
+ EA+ EKK E+R
Sbjct: 177 EEEAEAKDEKKTEEKR 192


>tr|Q4PE15|Q4PE15_USTMA Putative uncharacterized protein OS=Ustilago
maydis GN=UM01648.1 PE=4 SV=1
Length = 815

Score = 37.4 bits (85), Expect = 0.38
Identities = 20/59 (33%), Positives = 28/59 (47%)
Frame = -2

Query: 353 ESEMEGAVGSDPSVNLPVQGDASVKARSFDLPASAFVDLVQSINEQANDNIQNTEDVQE 177
E E++ + ++P NL V GD S+ A D A A L+Q +N A N D E
Sbjct: 458 EEELDTVIPTEPPANLDVDGDVSMAADQSDELAEALQSLIQGVNPDAISQSLNKLDQDE 516


>tr|Q2GRH8|Q2GRH8_CHAGB Putative uncharacterized protein
OS=Chaetomium globosum GN=CHGG_09426 PE=4 SV=1
Length = 794

Score = 37.4 bits (85), Expect = 0.38
Identities = 31/123 (25%), Positives = 55/123 (44%), Gaps = 4/123 (3%)
Frame = -2

Query: 404 DSLMSQNLQTRQKWESTE--SEMEGAVGSDPSVNLPVQGDASVKARSFDLPASAFVD--L 237
DSL + + T + T+ ME A D + DA + + +FV+ +
Sbjct: 186 DSLYKETIDTSDQTMFTDLTQAMEKAFSDDMEALNVLPPDAVTRVTEYVPQIVSFVEQII 245

Query: 236 VQSINEQANDNIQNTEDVQEAEKGGSTVQANLRPMNEESKSIPAEGKGSLEAELQKNAHE 57
+ +AN ++ D+ E+ G+T A LRP ++ K++ EG+GSL L+
Sbjct: 246 AKGFAYEANGSVYF--DIAAFEQAGNTY-ARLRPESKNDKALQEEGEGSLSKSLEGKKRS 302

Query: 56 AEF 48
+F
Sbjct: 303 GDF 305


>tr|Q4RP46|Q4RP46_TETNG Chromosome 1 SCAF15008, whole genome shotgun
sequence. (Fragment) OS=Tetraodon nigroviridis
GN=GSTENG00031281001 PE=4 SV=1
Length = 627

Score = 36.6 bits (83), Expect = 0.64
Identities = 32/129 (24%), Positives = 58/129 (44%), Gaps = 7/129 (5%)
Frame = -2

Query: 380 QTRQKWESTESEMEGAVGSDPSVNLPVQGDASVKARSFDLPASAFVDLVQSINEQANDNI 201
Q + W++T+ + +G+ D +Q + KA + A + S +EQ +
Sbjct: 463 QHKTYWDTTQEKWQGSEEKDAE-RKKIQSEKEKKADQRTSKSKANKKVETSESEQDKEK- 520

Query: 200 QNTEDVQEAEKGGSTV-------QANLRPMNEESKSIPAEGKGSLEAELQKNAHEAEFEK 42
+ +E QE KG S ++ E+S+S +GKG E + +K E+E +K
Sbjct: 521 EKSESEQEKGKGESEQDKEKEKSESEQDQEKEKSESEQEKGKGESEQDKEKEKSESELDK 580

Query: 41 KAYERRGDR 15
K E + D+
Sbjct: 581 K--EEKSDK 587


>tr|A8WXR3|A8WXR3_CAEBR Putative uncharacterized protein
OS=Caenorhabditis briggsae GN=CBG04495 PE=4 SV=2
Length = 2745

Score = 36.6 bits (83), Expect = 0.64
Identities = 31/134 (23%), Positives = 52/134 (38%)
Frame = -2

Query: 476 PDSGAHKTDFEGKLRKGEGGVELEDSLMSQNLQTRQKWESTESEMEGAVGSDPSVNLPVQ 297
PDS DF E L+ +N+ EST ++ + S+PS NL V
Sbjct: 1138 PDSSTQNLDFSKTPEPTESLENLDVDSGVENM------ESTSEDLAMPLDSEPSENLDVA 1191

Query: 296 GDASVKARSFDLPASAFVDLVQSINEQANDNIQNTEDVQEAEKGGSTVQANLRPMNEESK 117
G + + + VD++ + ++Q +N E QE G + + E
Sbjct: 1192 GSSQAEPEEVPMETDLNVDVLDNTSKQ-----KNAESTQEHGSCGGPNETEIAEKPESPV 1246

Query: 116 SIPAEGKGSLEAEL 75
S+ +EAE+
Sbjct: 1247 SLAEAVSTPVEAEV 1260


>tr|B2VQS7|B2VQS7_PYRTR Putative uncharacterized protein
OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP)
GN=PTRG_00421 PE=4 SV=1
Length = 893

Score = 36.6 bits (83), Expect = 0.64
Identities = 32/130 (24%), Positives = 56/130 (43%), Gaps = 3/130 (2%)
Frame = -2

Query: 404 DSLMSQNLQTRQKWESTESEMEGAVGS---DPSVNLPVQGDASVKARSFDLPASAFVDLV 234
++L +Q + W+ E+ + V + D + D KAR + A D +
Sbjct: 514 ETLQTQYSLASENWQGIETTLTSRVAALEKDRDETAKRESDVRRKAREVNSKARRLEDEL 573

Query: 233 QSINEQANDNIQNTEDVQEAEKGGSTVQANLRPMNEESKSIPAEGKGSLEAELQKNAHEA 54
+SINE+A Q D+ E +QA L ++++ + + LE E K EA
Sbjct: 574 ESINERARTFEQ---DLTEQRAAAQKLQAKL----TQAEAAAQDARADLERE--KKVWEA 624

Query: 53 EFEKKAYERR 24
E +++ E R
Sbjct: 625 ELQQRLEEER 634


>tr|Q9CGA2|Q9CGA2_LACLA Putative uncharacterized protein ymbJ
OS=Lactococcus lactis subsp. lactis GN=ymbJ PE=4 SV=1
Length = 749

Score = 36.2 bits (82), Expect = 0.84
Identities = 19/52 (36%), Positives = 32/52 (61%)
Frame = -2

Query: 272 SFDLPASAFVDLVQSINEQANDNIQNTEDVQEAEKGGSTVQANLRPMNEESK 117
SFD P S V L +S+++ +Q T D+ ++ + G+T QA+L P+N+ K
Sbjct: 391 SFDAPTSQKVTLWESVDQGDFKQVQ-TYDLSDSSESGATKQASLPPINQTGK 441


>tr|B4K453|B4K453_DROGR GH23407 OS=Drosophila grimshawi GN=GH23407
PE=4 SV=1
Length = 247

Score = 36.2 bits (82), Expect = 0.84
Identities = 33/144 (22%), Positives = 63/144 (43%), Gaps = 12/144 (8%)
Frame = -2

Query: 446 EGKLRKGEGGVELEDSLMSQNLQTRQKWESTESEME-------GAVGSDPSVNLPVQGDA 288
E + + E +EL++ SQ+ + Q+ ES E+E + A+ + P+ P D+
Sbjct: 2 EHEQEEEEEDLELDEQQESQDHEESQQRESQEAEPQQALAPHSSALAAPPTATTPQSPDS 61

Query: 287 SVKA-RSFDLPASAFVDLVQSINEQANDNI----QNTEDVQEAEKGGSTVQANLRPMNEE 123
+ A + FD S+ ++ A + NT++ +EA + V+ EE
Sbjct: 62 AATAGQLFDSSNSSDASSMKKAQMNACQALAKISSNTKEEEEAAEAEPEVETETEAEEEE 121

Query: 122 SKSIPAEGKGSLEAELQKNAHEAE 51
E + EAE+++ H A+
Sbjct: 122 EDEEEEEEEEEAEAEVEEVKHAAD 145