BP916623
Clone id YMU001_000089_G01
Library
Length 423
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000089_G01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GACAAATGAGAAATTGGATTGCAGTGTTTAAGTACAACCAAAGATTAATGTTTCTAACTT
CTGCTGAGTAGAGCACTTAAGCTGCTATCCACTTGGTCAAAAGTGAAGCACGAGGAACCA
TGCTGGATAAAAGAGCGCGAGTGAAAGCTGACTTTATTTTTCCTCGCCATGCTCTTCCTT
TATCACAAACATGTCTTGTTCCCTGCTCCATCCCAATCTTCAGTAAACGACTTTCGGACT
TCTATAGATATGCTTCGTCTCCAAAGCATGCACTCCTCTCTCTAGACCAGAAGTTGTAGC
ACGCCTCATTGGCGACCAAGGCTAAAAAAACGCTCCTCACTGCTCTGCACTGCACACAGG
CCTTCGCTTCAAACTCGCGGGTCACCCTGCTTGCTTTCGATGCCTTGCTCCAAGTGCGTA
TCT
■■Homology search results ■■ -
sp_hit_id Q6AXF6
Definition sp|Q6AXF6|SIDT1_MOUSE SID1 transmembrane family member 1 OS=Mus musculus
Align length 52
Score (bit) 32.3
E-value 0.78
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916623|Adiantum capillus-veneris mRNA, clone:
YMU001_000089_G01.
(423 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6AXF6|SIDT1_MOUSE SID1 transmembrane family member 1 OS=Mus ... 32 0.78
sp|Q9NXL6|SIDT1_HUMAN SID1 transmembrane family member 1 OS=Homo... 32 1.3
sp|Q30YX4|Y2325_DESDG UPF0082 protein Dde_2325 OS=Desulfovibrio ... 30 3.9
sp|Q63505|TF3C1_RAT General transcription factor 3C polypeptide ... 29 6.6
sp|Q5GSH2|SYS_WOLTR Seryl-tRNA synthetase OS=Wolbachia sp. subsp... 29 6.6
sp|Q6Q3F5|SIDT1_RAT SID1 transmembrane family member 1 OS=Rattus... 29 6.6
sp|Q5VYJ5|CJ112_HUMAN MAM and LDL-receptor class A domain-contai... 29 8.6

>sp|Q6AXF6|SIDT1_MOUSE SID1 transmembrane family member 1 OS=Mus
musculus GN=Sidt1 PE=2 SV=1
Length = 827

Score = 32.3 bits (72), Expect = 0.78
Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
Frame = +3

Query: 81 AAIHLVKSEARGTMLDKRARVKADF-IFPRHALPLSQTCLVPCSIPIFSKRL 233
+AIH++ S A T + R K D IF R A+ C+ CS P++ R+
Sbjct: 633 SAIHILSSLALSTQIYYMGRFKIDLGIFRRAAMVFYTDCIQQCSRPLYMDRM 684


>sp|Q9NXL6|SIDT1_HUMAN SID1 transmembrane family member 1 OS=Homo
sapiens GN=SIDT1 PE=2 SV=1
Length = 827

Score = 31.6 bits (70), Expect = 1.3
Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
Frame = +3

Query: 81 AAIHLVKSEARGTMLDKRARVKADF-IFPRHALPLSQTCLVPCSIPIFSKRL 233
+AIH++ S A T + R K D IF R A+ C+ CS P++ R+
Sbjct: 633 SAIHVLASLALSTQIYYMGRFKIDLGIFRRAAMVFYTDCIQQCSRPLYMDRM 684


>sp|Q30YX4|Y2325_DESDG UPF0082 protein Dde_2325 OS=Desulfovibrio
desulfuricans (strain G20) GN=Dde_2325 PE=3 SV=1
Length = 248

Score = 30.0 bits (66), Expect = 3.9
Identities = 15/33 (45%), Positives = 21/33 (63%)
Frame = -3

Query: 265 FGDEAYL*KSESRLLKIGMEQGTRHVCDKGRAW 167
F EAY SE +L++IG+E G V D+G +W
Sbjct: 141 FPKEAY---SEDQLMEIGLEAGCDDVIDEGDSW 170


>sp|Q63505|TF3C1_RAT General transcription factor 3C polypeptide 1
OS=Rattus norvegicus GN=Gtf3c1 PE=1 SV=1
Length = 2148

Score = 29.3 bits (64), Expect = 6.6
Identities = 11/26 (42%), Positives = 15/26 (57%)
Frame = -3

Query: 238 SESRLLKIGMEQGTRHVCDKGRAWRG 161
+ES + ++ E G VC GR WRG
Sbjct: 1952 TESNMAQVAWESGCERVCFVGRPWRG 1977


>sp|Q5GSH2|SYS_WOLTR Seryl-tRNA synthetase OS=Wolbachia sp. subsp.
Brugia malayi (strain TRS) GN=serS PE=3 SV=1
Length = 425

Score = 29.3 bits (64), Expect = 6.6
Identities = 19/47 (40%), Positives = 23/47 (48%)
Frame = -3

Query: 319 LVANEACYNFWSRERSACFGDEAYL*KSESRLLKIGMEQGTRHVCDK 179
LV NEA YN + F D++YL E RL+ G T V DK
Sbjct: 199 LVKNEAMYNVGQLPK---FSDDSYLTTDELRLIPTGEVVLTNSVADK 242


>sp|Q6Q3F5|SIDT1_RAT SID1 transmembrane family member 1 OS=Rattus
norvegicus GN=Sidt1 PE=2 SV=2
Length = 831

Score = 29.3 bits (64), Expect = 6.6
Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 6/57 (10%)
Frame = +3

Query: 81 AAIHLVKSEARGTMLDKRARVKADF------IFPRHALPLSQTCLVPCSIPIFSKRL 233
+AIH++ S A T + R K D IF R A+ C+ CS P++ R+
Sbjct: 632 SAIHVLASLALSTQIYYMGRFKIDVSDTDLGIFRRAAMVFYTDCIQQCSRPLYMDRM 688


>sp|Q5VYJ5|CJ112_HUMAN MAM and LDL-receptor class A
domain-containing protein C10orf112 OS=Homo sapiens
GN=C10orf112 PE=2 SV=2
Length = 1229

Score = 28.9 bits (63), Expect = 8.6
Identities = 13/26 (50%), Positives = 16/26 (61%)
Frame = -3

Query: 295 NFWSRERSACFGDEAYL*KSESRLLK 218
NFW RE + FGDE + K E R+ K
Sbjct: 473 NFWRREELSLFGDEDFQLKFEGRVGK 498


tr_hit_id Q0I774
Definition tr|Q0I774|Q0I774_SYNS3 ATPase OS=Synechococcus sp. (strain CC9311)
Align length 49
Score (bit) 35.4
E-value 1.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916623|Adiantum capillus-veneris mRNA, clone:
YMU001_000089_G01.
(423 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q0I774|Q0I774_SYNS3 ATPase OS=Synechococcus sp. (strain CC931... 35 1.4

>tr|Q0I774|Q0I774_SYNS3 ATPase OS=Synechococcus sp. (strain CC9311)
GN=sync_2504 PE=4 SV=1
Length = 733

Score = 35.4 bits (80), Expect = 1.4
Identities = 18/49 (36%), Positives = 28/49 (57%)
Frame = +1

Query: 259 LQSMHSSL*TRSCSTPHWRPRLKKRSSLLCTAHRPSLQTRGSPCLLSMP 405
L ++H T CSTP + RL+ + LL HRP+L + G+ L ++P
Sbjct: 514 LNAVHEGSVTILCSTPEEQARLEAQLDLLDPLHRPNLLSGGTKALETLP 562