BP916630
Clone id YMU001_000089_G08
Library
Length 550
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000089_G08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTGGAAGAATTTGCGGCCGCGAATTTTTTTTTTTTTTGTTACACACACAAGCACATAATA
AGAATGGTTTTATTACATTTCTGTTTATAACCTAAGGGCCTGTCTATCCTTTTGTGATGC
TGTTGAGTTTGCTCTGAGTGGGCATCTCCTCTTGCTGCCTTCTTTTATATACATGCTTCC
AAAATTAGCACATACTTGTGCTCCCAATTTCCATCTACTCTTCCTGATCTTCATAGTCTT
TCCCTGAAGCTCACACTGCCAGCTGAGCACCTACGTACATCCTTGTCGCCTTAATACCAA
CCTTCTCTTGATGTTAGAAGCACCCACAATCCTTTTCTCATCCCTTAGTTCCCAATCAAC
AACCTTCTTTCTGCCCTCTTTCTTGTCCGATCAGCCTGAGATAGTAAATCAACCAGAGCT
TCCTGATGGTTCCCCTGTTATTGCACCACTGCCACCGGAAGTTGAGCCTGCTCCTCCAAC
TGTTTGCCCACTTCTTGCTGCACGCGCTCGCTGCAATTGTCTCAATCTAAAGACATCTGG
AGTCCGATTC
■■Homology search results ■■ -
sp_hit_id Q6L8G8
Definition sp|Q6L8G8|KRA57_HUMAN Keratin-associated protein 5-7 OS=Homo sapiens
Align length 33
Score (bit) 31.6
E-value 2.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916630|Adiantum capillus-veneris mRNA, clone:
YMU001_000089_G08.
(510 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6L8G8|KRA57_HUMAN Keratin-associated protein 5-7 OS=Homo sap... 32 2.3
sp|Q701N4|KRA52_HUMAN Keratin-associated protein 5-2 OS=Homo sap... 31 2.9
sp|Q6L8G9|KRA56_HUMAN Keratin-associated protein 5-6 OS=Homo sap... 31 3.9
sp|Q701N2|KRA55_HUMAN Keratin-associated protein 5-5 OS=Homo sap... 31 3.9
sp|A3CLP1|SEPF_STRSV Cell division protein sepF OS=Streptococcus... 30 6.5
sp|O88799|ZAN_MOUSE Zonadhesin OS=Mus musculus GN=Zan PE=2 SV=1 30 8.6
sp|Q6L8H2|KRA53_HUMAN Keratin-associated protein 5-3 OS=Homo sap... 30 8.6

>sp|Q6L8G8|KRA57_HUMAN Keratin-associated protein 5-7 OS=Homo
sapiens GN=KRTAP5-7 PE=2 SV=1
Length = 165

Score = 31.6 bits (70), Expect = 2.3
Identities = 12/33 (36%), Positives = 18/33 (54%)
Frame = +3

Query: 372 TRAS*WFPCYCTTATGS*ACSSNCLPTSCCTRS 470
++ S + PC C++ GS C S+C CC S
Sbjct: 93 SQCSCYKPCCCSSGCGSSCCQSSCCKPCCCQSS 125


>sp|Q701N4|KRA52_HUMAN Keratin-associated protein 5-2 OS=Homo
sapiens GN=KRTAP5-2 PE=2 SV=1
Length = 177

Score = 31.2 bits (69), Expect = 2.9
Identities = 11/26 (42%), Positives = 14/26 (53%)
Frame = +3

Query: 393 PCYCTTATGS*ACSSNCLPTSCCTRS 470
PC C++ GS C S+C CC S
Sbjct: 121 PCCCSSGCGSSCCQSSCCKPCCCQSS 146


>sp|Q6L8G9|KRA56_HUMAN Keratin-associated protein 5-6 OS=Homo
sapiens GN=KRTAP5-6 PE=2 SV=1
Length = 129

Score = 30.8 bits (68), Expect = 3.9
Identities = 11/26 (42%), Positives = 17/26 (65%)
Frame = +3

Query: 393 PCYCTTATGS*ACSSNCLPTSCCTRS 470
PCYC++ GS C S+C CC+++
Sbjct: 93 PCYCSSGCGSSCCQSSCC-KPCCSQA 117


>sp|Q701N2|KRA55_HUMAN Keratin-associated protein 5-5 OS=Homo
sapiens GN=KRTAP5-5 PE=2 SV=2
Length = 237

Score = 30.8 bits (68), Expect = 3.9
Identities = 11/26 (42%), Positives = 14/26 (53%)
Frame = +3

Query: 393 PCYCTTATGS*ACSSNCLPTSCCTRS 470
PC C++ GS C S+C CC S
Sbjct: 162 PCCCSSGCGSSCCQSSCCKPYCCQSS 187



Score = 30.0 bits (66), Expect = 6.6
Identities = 11/26 (42%), Positives = 13/26 (50%)
Frame = +3

Query: 393 PCYCTTATGS*ACSSNCLPTSCCTRS 470
PC C + GS C S+C CC S
Sbjct: 201 PCSCFSGCGSSCCQSSCYKPCCCQSS 226


>sp|A3CLP1|SEPF_STRSV Cell division protein sepF OS=Streptococcus
sanguinis (strain SK36) GN=sepF PE=3 SV=1
Length = 199

Score = 30.0 bits (66), Expect = 6.5
Identities = 12/37 (32%), Positives = 21/37 (56%)
Frame = +1

Query: 28 FYYISVYNLRACLSFCDAVEFALSGHLLLLPSFIYML 138
F Y++ R CL + D + L+G+L + S +Y+L
Sbjct: 132 FQYMTEVQARRCLDYLDGARYVLAGNLKKVASTMYLL 168


>sp|O88799|ZAN_MOUSE Zonadhesin OS=Mus musculus GN=Zan PE=2 SV=1
Length = 5376

Score = 29.6 bits (65), Expect = 8.6
Identities = 11/25 (44%), Positives = 16/25 (64%)
Frame = +2

Query: 287 QSFSHPLVPNQQPSFCPLSCPISLR 361
Q +P+ P ++P FCPL CP + R
Sbjct: 1536 QDAGYPVKPWREPQFCPLVCPKNSR 1560


>sp|Q6L8H2|KRA53_HUMAN Keratin-associated protein 5-3 OS=Homo
sapiens GN=KRTAP5-3 PE=2 SV=1
Length = 238

Score = 29.6 bits (65), Expect = 8.6
Identities = 12/33 (36%), Positives = 18/33 (54%)
Frame = +3

Query: 372 TRAS*WFPCYCTTATGS*ACSSNCLPTSCCTRS 470
++ S + PC C++ GS C S+C SC S
Sbjct: 127 SQCSCYKPCCCSSGCGSSCCQSSCCKPSCSQSS 159


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916630|Adiantum capillus-veneris mRNA, clone:
YMU001_000089_G08.
(510 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******