BP916669
Clone id YMU001_000090_C01
Library
Length 502
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000090_C01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
AGCAAGGTTTCCATGCCTCATAAATTGGTACACAAGGTATAGTCCTTTTTCAATGCAATA
GCCAACCAAGGGAGTGATGTTCGGATGAAGGGCATGGCATATCATGCCAATCTCTGTCAG
AAAGTCTACTGTTCTCTGGTCACCCGTATCTCCTCGTATCAGGCTCTTTACAGCAACAAG
CTCACCTTCACCTAGGATCCCCTTATAAACCTCTGAATGCCCGCCCTTTCCTACCAGATT
ATCTTTATTGAATCGACTAGTAGCCTTCGAGATTTCTTCGTAAGTGAGAACTTTCCACGA
CGTTCCAACTGCCATAATTGGGATCCTTGTGTTAGCCCACTTCCAAGGCCACACACTACT
TATCAAAGACTGCAAAGTGAATTTCCATGCCTTCAATCGTTTGCGTTGTCGAGCTGACAG
AAAGATATGCATGCCACATTCCTGAATATTACTCCTCCTTATGCTCAAACAGCTACAGTT
CTGTCTTGTCTGTACATAATTC
■■Homology search results ■■ -
sp_hit_id O22476
Definition sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana
Align length 119
Score (bit) 75.9
E-value 1.0e-13
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916669|Adiantum capillus-veneris mRNA, clone:
YMU001_000090_C01.
(502 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Ar... 76 1e-13
sp|Q9LZM4|WAKLQ_ARATH Putative wall-associated receptor kinase-l... 75 1e-13
sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvian... 75 1e-13
sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Sola... 75 1e-13
sp|Q9LJF3|BRL3_ARATH Serine/threonine-protein kinase BRI1-like 3... 75 2e-13
sp|O24585|CRI4_MAIZE Putative receptor protein kinase CRINKLY4 O... 74 4e-13
sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1... 74 5e-13
sp|Q9M342|WAKLP_ARATH Wall-associated receptor kinase-like 15 OS... 73 7e-13
sp|Q7X8C5|WAKLB_ARATH Wall-associated receptor kinase-like 2 OS=... 72 1e-12
sp|Q8LPB4|PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota... 72 1e-12
sp|Q9C8M9|SRF6_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 6 OS=Ara... 71 2e-12
sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2... 70 4e-12
sp|Q3EDL4|Y1154_ARATH Putative serine/threonine-protein kinase A... 70 6e-12
sp|Q8RY17|WAKLI_ARATH Wall-associated receptor kinase-like 22 OS... 70 6e-12
sp|Q9S9M2|WAKLD_ARATH Wall-associated receptor kinase-like 4 OS=... 70 7e-12
sp|Q8L4H4|NORK_MEDTR Nodulation receptor kinase OS=Medicago trun... 69 9e-12
sp|Q9C9L5|WAKLH_ARATH Putative wall-associated receptor kinase-l... 69 2e-11
sp|O48814|BIK1_ARATH Serine/threonine-protein kinase BIK1 OS=Ara... 69 2e-11
sp|Q8VYA3|WAKLJ_ARATH Wall-associated receptor kinase-like 10 OS... 68 3e-11
sp|Q8LKZ1|NORK_PEA Nodulation receptor kinase OS=Pisum sativum G... 68 3e-11
sp|O23081|CRK41_ARATH Cysteine-rich receptor-like protein kinase... 67 4e-11
sp|Q9M0X5|CRK25_ARATH Cysteine-rich receptor-like protein kinase... 67 4e-11
sp|Q9S9M5|WAKLA_ARATH Wall-associated receptor kinase-like 1 OS=... 67 5e-11
sp|Q6R2J8|SRF8_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 8 OS=Ara... 67 5e-11
sp|Q9FE20|PBS1_ARATH Serine/threonine-protein kinase PBS1 OS=Ara... 67 5e-11
sp|Q8GYF5|WAKLR_ARATH Wall-associated receptor kinase-like 21 OS... 67 6e-11
sp|Q9LUL4|SRF7_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 7 OS=Ara... 67 6e-11
sp|Q9C7S5|PSYR1_ARATH Tyrosine-sulfated glycopeptide receptor 1 ... 67 6e-11
sp|Q9ZVR7|PSKR1_ARATH Phytosulfokine receptor 1 OS=Arabidopsis t... 67 6e-11
sp|O65472|CRK12_ARATH Putative cysteine-rich receptor-like prote... 67 6e-11

>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1
OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1
Length = 1196

Score = 75.9 bits (185), Expect = 1e-13
Identities = 43/119 (36%), Positives = 67/119 (56%), Gaps = 5/119 (4%)
Frame = -2

Query: 345 WKWANTR----IPIMAVGTSWKVLTYEEISKATSRFNKDNLVGKGGHSEVYKGILGEGEL 178
WK + I + A + LT+ ++ +AT+ F+ D+L+G GG +VYK IL +G
Sbjct: 848 WKLTGVKEALSINLAAFEKPLRKLTFADLLQATNGFHNDSLIGSGGFGDVYKAILKDGSA 907

Query: 177 VAVKSLIRGDTGDQRTVDFLTEIGMICHALHPNITPLVGYC-IEKGLYLVYQFMRHGNL 4
VA+K LI Q +F+ E+ I H N+ PL+GYC + LVY+FM++G+L
Sbjct: 908 VAIKKLIH--VSGQGDREFMAEMETIGKIKHRNLVPLLGYCKVGDERLLVYEFMKYGSL 964


>sp|Q9LZM4|WAKLQ_ARATH Putative wall-associated receptor kinase-like
20 OS=Arabidopsis thaliana GN=WAKL20 PE=3 SV=1
Length = 657

Score = 75.5 bits (184), Expect = 1e-13
Identities = 38/104 (36%), Positives = 64/104 (61%), Gaps = 1/104 (0%)
Frame = -2

Query: 312 AVGTSWKVLTYEEISKATSRFNKDNLVGKGGHSEVYKGILGEGELVAVKSLIRGDTGDQR 133
+ G S ++ T EI+KAT+ F+KDNL+G GG EV+K +L +G + A+K +T +
Sbjct: 343 STGKSSRIFTGREITKATNNFSKDNLIGTGGFGEVFKAVLEDGTITAIKRAKLNNT--KG 400

Query: 132 TVDFLTEIGMICHALHPNITPLVGYCIEKGL-YLVYQFMRHGNL 4
T L E+ ++C H ++ L+G C++ L L+Y+F+ +G L
Sbjct: 401 TDQILNEVRILCQVNHRSLVRLLGCCVDLELPLLIYEFIPNGTL 444


>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum
PE=1 SV=1
Length = 1207

Score = 75.5 bits (184), Expect = 1e-13
Identities = 43/119 (36%), Positives = 69/119 (57%), Gaps = 5/119 (4%)
Frame = -2

Query: 345 WKWANTR----IPIMAVGTSWKVLTYEEISKATSRFNKDNLVGKGGHSEVYKGILGEGEL 178
WK+ + R I + A + LT+ ++ +AT+ F+ D+LVG GG +VYK L +G +
Sbjct: 853 WKFTSAREALSINLAAFEKPLRKLTFADLLEATNGFHNDSLVGSGGFGDVYKAQLKDGSV 912

Query: 177 VAVKSLIRGDTGDQRTVDFLTEIGMICHALHPNITPLVGYC-IEKGLYLVYQFMRHGNL 4
VA+K LI Q +F E+ I H N+ PL+GYC + + LVY++M++G+L
Sbjct: 913 VAIKKLIH--VSGQGDREFTAEMETIGKIKHRNLVPLLGYCKVGEERLLVYEYMKYGSL 969


>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum
lycopersicum GN=CURL3 PE=1 SV=1
Length = 1207

Score = 75.5 bits (184), Expect = 1e-13
Identities = 43/119 (36%), Positives = 69/119 (57%), Gaps = 5/119 (4%)
Frame = -2

Query: 345 WKWANTR----IPIMAVGTSWKVLTYEEISKATSRFNKDNLVGKGGHSEVYKGILGEGEL 178
WK+ + R I + A + LT+ ++ +AT+ F+ D+LVG GG +VYK L +G +
Sbjct: 853 WKFTSAREALSINLAAFEKPLRKLTFADLLEATNGFHNDSLVGSGGFGDVYKAQLKDGSV 912

Query: 177 VAVKSLIRGDTGDQRTVDFLTEIGMICHALHPNITPLVGYC-IEKGLYLVYQFMRHGNL 4
VA+K LI Q +F E+ I H N+ PL+GYC + + LVY++M++G+L
Sbjct: 913 VAIKKLIH--VSGQGDREFTAEMETIGKIKHRNLVPLLGYCKVGEERLLVYEYMKYGSL 969


>sp|Q9LJF3|BRL3_ARATH Serine/threonine-protein kinase BRI1-like 3
OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1
Length = 1164

Score = 74.7 bits (182), Expect = 2e-13
Identities = 49/149 (32%), Positives = 86/149 (57%), Gaps = 6/149 (4%)
Frame = -2

Query: 432 MHIFLSARQRKRLKAWKFTLQSL-ISSVWPWKWANTRIPI-MAVGTSWKVL---TYEEIS 268
M ++ + + +K+ K + ++SL S WK ++ P+ + V T K L T+ +
Sbjct: 793 MALYRARKVQKKEKQREKYIESLPTSGSSSWKLSSVHEPLSINVATFEKPLRKLTFAHLL 852

Query: 267 KATSRFNKDNLVGKGGHSEVYKGILGEGELVAVKSLIRGDTGDQRTVDFLTEIGMICHAL 88
+AT+ F+ D+++G GG +VYK L +G +VA+K LI+ Q +F+ E+ I
Sbjct: 853 EATNGFSADSMIGSGGFGDVYKAKLADGSVVAIKKLIQ--VTGQGDREFMAEMETIGKIK 910

Query: 87 HPNITPLVGYC-IEKGLYLVYQFMRHGNL 4
H N+ PL+GYC I + LVY++M++G+L
Sbjct: 911 HRNLVPLLGYCKIGEERLLVYEYMKYGSL 939


>sp|O24585|CRI4_MAIZE Putative receptor protein kinase CRINKLY4
OS=Zea mays GN=CR4 PE=2 SV=1
Length = 901

Score = 73.9 bits (180), Expect = 4e-13
Identities = 38/95 (40%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
Frame = -2

Query: 285 TYEEISKATSRFNKDNLVGKGGHSEVYKGILGEGELVAVKSLIRGDTGDQRTVDFLTEIG 106
+YEE+ +AT F++D+ VGKG S V+KGIL +G +VAVK I+ + + +F E+
Sbjct: 494 SYEELEQATGGFSEDSQVGKGSFSCVFKGILRDGTVVAVKRAIKASDVKKSSKEFHNELD 553

Query: 105 MICHALHPNITPLVGYCIE-KGLYLVYQFMRHGNL 4
++ H ++ L+GYC + LVY+FM HG+L
Sbjct: 554 LLSRLNHAHLLNLLGYCEDGSERLLVYEFMAHGSL 588


>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1
OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1
Length = 1166

Score = 73.6 bits (179), Expect = 5e-13
Identities = 51/140 (36%), Positives = 78/140 (55%), Gaps = 5/140 (3%)
Frame = -2

Query: 408 QRKRLKAWKFTLQSLISSVWPWKWANTRIPI-MAVGTSWKVL---TYEEISKATSRFNKD 241
Q+K K K+ S WK ++ P+ + V T K L T+ + +AT+ F+ +
Sbjct: 803 QKKEQKREKYIESLPTSGSCSWKLSSVPEPLSINVATFEKPLRKLTFAHLLEATNGFSAE 862

Query: 240 NLVGKGGHSEVYKGILGEGELVAVKSLIRGDTGDQRTVDFLTEIGMICHALHPNITPLVG 61
+VG GG EVYK L +G +VA+K LIR TG Q +F+ E+ I H N+ PL+G
Sbjct: 863 TMVGSGGFGEVYKAQLRDGSVVAIKKLIR-ITG-QGDREFMAEMETIGKIKHRNLVPLLG 920

Query: 60 YC-IEKGLYLVYQFMRHGNL 4
YC + + LVY++M+ G+L
Sbjct: 921 YCKVGEERLLVYEYMKWGSL 940


>sp|Q9M342|WAKLP_ARATH Wall-associated receptor kinase-like 15
OS=Arabidopsis thaliana GN=WAKL15 PE=2 SV=2
Length = 639

Score = 73.2 bits (178), Expect = 7e-13
Identities = 45/120 (37%), Positives = 69/120 (57%), Gaps = 8/120 (6%)
Frame = -2

Query: 339 WANTR------IPIMAVGTSWKVLTYEEISKATSRFNKDNLVGKGGHSEVYKGILGEGEL 178
WA+ R + I + G ++ T +EI KAT F K NL+G GG EV+KG L +G
Sbjct: 320 WASVRKLHRNLLSINSTGLD-RIFTGKEIVKATDNFAKSNLLGFGGFGEVFKGNLDDGTT 378

Query: 177 VAVKSLIRGDTGDQRTV-DFLTEIGMICHALHPNITPLVGYCIEKGL-YLVYQFMRHGNL 4
VAVK R G+++++ + E+ ++C H N+ L+G CIE + LVY+F+ +G L
Sbjct: 379 VAVK---RAKLGNEKSIYQIVNEVQILCQVSHKNLVKLLGCCIELEMPVLVYEFVPNGTL 435


>sp|Q7X8C5|WAKLB_ARATH Wall-associated receptor kinase-like 2
OS=Arabidopsis thaliana GN=WAKL2 PE=2 SV=1
Length = 748

Score = 72.0 bits (175), Expect = 1e-12
Identities = 37/98 (37%), Positives = 61/98 (62%), Gaps = 1/98 (1%)
Frame = -2

Query: 294 KVLTYEEISKATSRFNKDNLVGKGGHSEVYKGILGEGELVAVKSLIRGDTGDQRTVDFLT 115
++ + E+ KAT FNK+ ++G+GG VYKG+L +G +VAVK D + R +F+
Sbjct: 402 RIFSSHELEKATDNFNKNRVLGQGGQGTVYKGMLVDGRIVAVKRSKAVD--EDRVEEFIN 459

Query: 114 EIGMICHALHPNITPLVGYCIEKGL-YLVYQFMRHGNL 4
E+ ++ H NI L+G C+E + LVY+F+ +G+L
Sbjct: 460 EVVVLAQINHRNIVKLLGCCLETEVPVLVYEFVPNGDL 497


>sp|Q8LPB4|PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota
GN=PSKR PE=1 SV=1
Length = 1021

Score = 72.0 bits (175), Expect = 1e-12
Identities = 41/96 (42%), Positives = 59/96 (61%), Gaps = 1/96 (1%)
Frame = -2

Query: 288 LTYEEISKATSRFNKDNLVGKGGHSEVYKGILGEGELVAVKSLIRGDTGDQRTVDFLTEI 109
L+ ++I K+TS FN+ N++G GG VYK L +G VA+K L GDTG Q +F E+
Sbjct: 731 LSLDDILKSTSSFNQANIIGCGGFGLVYKATLPDGTKVAIKRL-SGDTG-QMDREFQAEV 788

Query: 108 GMICHALHPNITPLVGYCIEKG-LYLVYQFMRHGNL 4
+ A HPN+ L+GYC K L+Y +M +G+L
Sbjct: 789 ETLSRAQHPNLVHLLGYCNYKNDKLLIYSYMDNGSL 824


tr_hit_id A7VM42
Definition tr|A7VM42|A7VM42_MARPO Receptor-like kinase OS=Marchantia polymorpha
Align length 99
Score (bit) 123.0
E-value 6.0e-27
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916669|Adiantum capillus-veneris mRNA, clone:
YMU001_000090_C01.
(502 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7VM42|A7VM42_MARPO Receptor-like kinase OS=Marchantia polymo... 123 6e-27
tr|A7Q6D5|A7Q6D5_VITVI Chromosome chr11 scaffold_56, whole genom... 118 1e-25
tr|Q653Y9|Q653Y9_ORYSJ (RAP Annotation release2) Protein kinase-... 114 3e-24
tr|Q653Y8|Q653Y8_ORYSJ cDNA clone:J023111J08, full insert sequen... 114 3e-24
tr|Q653Y7|Q653Y7_ORYSJ Putative receptor protein kinase PERK1 (P... 114 3e-24
tr|B8B115|B8B115_ORYSI Putative uncharacterized protein OS=Oryza... 114 3e-24
tr|B7F3Z7|B7F3Z7_ORYSJ (RAP Annotation release2) Protein kinase-... 114 3e-24
tr|Q6YW24|Q6YW24_ORYSJ Os08g0249100 protein OS=Oryza sativa subs... 113 6e-24
tr|B8B8Q8|B8B8Q8_ORYSI Putative uncharacterized protein OS=Oryza... 113 6e-24
tr|A3BR62|A3BR62_ORYSJ Putative uncharacterized protein OS=Oryza... 113 6e-24
tr|A9SSS5|A9SSS5_PHYPA Predicted protein OS=Physcomitrella paten... 110 4e-23
tr|B6U4H5|B6U4H5_MAIZE ATP binding protein OS=Zea mays PE=2 SV=1 110 5e-23
tr|Q7XTD9|Q7XTD9_ORYSJ OSJNBb0022F16.6 protein OS=Oryza sativa s... 108 1e-22
tr|Q0J9G2|Q0J9G2_ORYSJ Os04g0654600 protein OS=Oryza sativa subs... 108 1e-22
tr|Q01KL6|Q01KL6_ORYSA OSIGBa0147J19.3 protein OS=Oryza sativa G... 108 1e-22
tr|B8AVL5|B8AVL5_ORYSI Putative uncharacterized protein OS=Oryza... 108 1e-22
tr|B6SKM9|B6SKM9_MAIZE ATP binding protein OS=Zea mays PE=2 SV=1 108 1e-22
tr|A7PU27|A7PU27_VITVI Chromosome chr7 scaffold_31, whole genome... 108 1e-22
tr|A5ACQ1|A5ACQ1_VITVI Putative uncharacterized protein OS=Vitis... 108 1e-22
tr|Q9LSM2|Q9LSM2_ARATH Similarity to lectin-like protein kinase ... 106 5e-22
tr|Q8GWR7|Q8GWR7_ARATH Putative uncharacterized protein At5g6553... 106 5e-22
tr|A7R175|A7R175_VITVI Chromosome undetermined scaffold_340, who... 106 5e-22
tr|A7Q6N6|A7Q6N6_VITVI Chromosome chr11 scaffold_56, whole genom... 106 7e-22
tr|B4FWT2|B4FWT2_MAIZE Putative uncharacterized protein OS=Zea m... 105 9e-22
tr|B4FJ96|B4FJ96_MAIZE Putative uncharacterized protein OS=Zea m... 105 9e-22
tr|Q8GXZ5|Q8GXZ5_ARATH Putative uncharacterized protein At5g1891... 105 1e-21
tr|A7NWB4|A7NWB4_VITVI Chromosome chr5 scaffold_2, whole genome ... 105 1e-21
tr|Q682Z0|Q682Z0_ARATH Putative uncharacterized protein At2g1889... 104 2e-21
tr|O64619|O64619_ARATH Putative uncharacterized protein At2g1889... 104 2e-21
tr|Q9FGC3|Q9FGC3_ARATH Serine/threonine protein kinase-like OS=A... 103 4e-21

>tr|A7VM42|A7VM42_MARPO Receptor-like kinase OS=Marchantia
polymorpha GN=MpRLK26 PE=2 SV=1
Length = 749

Score = 123 bits (308), Expect = 6e-27
Identities = 52/99 (52%), Positives = 74/99 (74%)
Frame = -2

Query: 297 WKVLTYEEISKATSRFNKDNLVGKGGHSEVYKGILGEGELVAVKSLIRGDTGDQRTVDFL 118
WK T+EE++ AT FN N+VGKGG++EVY+G L +G +AVK LI+GDT +++ FL
Sbjct: 414 WKFFTFEELAIATDNFNPGNIVGKGGYAEVYRGSLSDGSTIAVKKLIKGDTEEEKETFFL 473

Query: 117 TEIGMICHALHPNITPLVGYCIEKGLYLVYQFMRHGNLA 1
TE+G++ H HPN T ++G+CIE GL+LV+ F HG+LA
Sbjct: 474 TELGIVSHVSHPNTTEIIGFCIEGGLHLVFHFYHHGSLA 512


>tr|A7Q6D5|A7Q6D5_VITVI Chromosome chr11 scaffold_56, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00031352001
PE=4 SV=1
Length = 340

Score = 118 bits (296), Expect = 1e-25
Identities = 53/100 (53%), Positives = 74/100 (74%)
Frame = -2

Query: 300 SWKVLTYEEISKATSRFNKDNLVGKGGHSEVYKGILGEGELVAVKSLIRGDTGDQRTVDF 121
+WK +YEEI ATS F+ DNLVGKGG++EVY+G L +GE VAVK L + T +++ +F
Sbjct: 53 TWKCFSYEEIFHATSGFSSDNLVGKGGYAEVYRGTLEDGEAVAVKRLTKASTDERKEKEF 112

Query: 120 LTEIGMICHALHPNITPLVGYCIEKGLYLVYQFMRHGNLA 1
LTEIG I H HPN++ L+G CI+ GLYL++QF G+++
Sbjct: 113 LTEIGTIGHVCHPNVSSLLGCCIDNGLYLIFQFFSRGSVS 152


>tr|Q653Y9|Q653Y9_ORYSJ (RAP Annotation release2) Protein
kinase-like domain containing protein OS=Oryza sativa
subsp. japonica GN=OSJNBb0065C04.50-1 PE=2 SV=1
Length = 550

Score = 114 bits (285), Expect = 3e-24
Identities = 51/100 (51%), Positives = 70/100 (70%)
Frame = -2

Query: 300 SWKVLTYEEISKATSRFNKDNLVGKGGHSEVYKGILGEGELVAVKSLIRGDTGDQRTVDF 121
SW+ Y E+ AT +F+ +NL+GKGGH+EVYKG L +G+ VAVK L +G + R DF
Sbjct: 218 SWRSFDYSELCAATDKFSSENLIGKGGHAEVYKGHLADGQFVAVKRLTKGGNKEDRISDF 277

Query: 120 LTEIGMICHALHPNITPLVGYCIEKGLYLVYQFMRHGNLA 1
L+E+G+I H HPN L+G+ +E GL+LV QF HG+LA
Sbjct: 278 LSELGIIAHVNHPNAAQLLGFSVEGGLHLVLQFSPHGSLA 317


>tr|Q653Y8|Q653Y8_ORYSJ cDNA clone:J023111J08, full insert sequence
OS=Oryza sativa subsp. japonica GN=OSJNBb0065C04.50-3
PE=2 SV=1
Length = 356

Score = 114 bits (285), Expect = 3e-24
Identities = 51/100 (51%), Positives = 70/100 (70%)
Frame = -2

Query: 300 SWKVLTYEEISKATSRFNKDNLVGKGGHSEVYKGILGEGELVAVKSLIRGDTGDQRTVDF 121
SW+ Y E+ AT +F+ +NL+GKGGH+EVYKG L +G+ VAVK L +G + R DF
Sbjct: 218 SWRSFDYSELCAATDKFSSENLIGKGGHAEVYKGHLADGQFVAVKRLTKGGNKEDRISDF 277

Query: 120 LTEIGMICHALHPNITPLVGYCIEKGLYLVYQFMRHGNLA 1
L+E+G+I H HPN L+G+ +E GL+LV QF HG+LA
Sbjct: 278 LSELGIIAHVNHPNAAQLLGFSVEGGLHLVLQFSPHGSLA 317


>tr|Q653Y7|Q653Y7_ORYSJ Putative receptor protein kinase PERK1
(Putative uncharacterized protein) OS=Oryza sativa
subsp. japonica GN=OSJNBb0065C04.50-2 PE=4 SV=1
Length = 555

Score = 114 bits (285), Expect = 3e-24
Identities = 51/100 (51%), Positives = 70/100 (70%)
Frame = -2

Query: 300 SWKVLTYEEISKATSRFNKDNLVGKGGHSEVYKGILGEGELVAVKSLIRGDTGDQRTVDF 121
SW+ Y E+ AT +F+ +NL+GKGGH+EVYKG L +G+ VAVK L +G + R DF
Sbjct: 223 SWRSFDYSELCAATDKFSSENLIGKGGHAEVYKGHLADGQFVAVKRLTKGGNKEDRISDF 282

Query: 120 LTEIGMICHALHPNITPLVGYCIEKGLYLVYQFMRHGNLA 1
L+E+G+I H HPN L+G+ +E GL+LV QF HG+LA
Sbjct: 283 LSELGIIAHVNHPNAAQLLGFSVEGGLHLVLQFSPHGSLA 322


>tr|B8B115|B8B115_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_24017 PE=4 SV=1
Length = 550

Score = 114 bits (285), Expect = 3e-24
Identities = 51/100 (51%), Positives = 70/100 (70%)
Frame = -2

Query: 300 SWKVLTYEEISKATSRFNKDNLVGKGGHSEVYKGILGEGELVAVKSLIRGDTGDQRTVDF 121
SW+ Y E+ AT +F+ +NL+GKGGH+EVYKG L +G+ VAVK L +G + R DF
Sbjct: 218 SWRSFDYSELCAATDKFSSENLIGKGGHAEVYKGHLADGQFVAVKRLTKGGNKEDRISDF 277

Query: 120 LTEIGMICHALHPNITPLVGYCIEKGLYLVYQFMRHGNLA 1
L+E+G+I H HPN L+G+ +E GL+LV QF HG+LA
Sbjct: 278 LSELGIIAHVNHPNAAQLLGFSVEGGLHLVLQFSPHGSLA 317


>tr|B7F3Z7|B7F3Z7_ORYSJ (RAP Annotation release2) Protein
kinase-like domain containing protein OS=Oryza sativa
subsp. japonica PE=2 SV=1
Length = 446

Score = 114 bits (285), Expect = 3e-24
Identities = 51/100 (51%), Positives = 70/100 (70%)
Frame = -2

Query: 300 SWKVLTYEEISKATSRFNKDNLVGKGGHSEVYKGILGEGELVAVKSLIRGDTGDQRTVDF 121
SW+ Y E+ AT +F+ +NL+GKGGH+EVYKG L +G+ VAVK L +G + R DF
Sbjct: 114 SWRSFDYSELCAATDKFSSENLIGKGGHAEVYKGHLADGQFVAVKRLTKGGNKEDRISDF 173

Query: 120 LTEIGMICHALHPNITPLVGYCIEKGLYLVYQFMRHGNLA 1
L+E+G+I H HPN L+G+ +E GL+LV QF HG+LA
Sbjct: 174 LSELGIIAHVNHPNAAQLLGFSVEGGLHLVLQFSPHGSLA 213


>tr|Q6YW24|Q6YW24_ORYSJ Os08g0249100 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0012K14.9 PE=2 SV=1
Length = 601

Score = 113 bits (282), Expect = 6e-24
Identities = 50/100 (50%), Positives = 73/100 (73%)
Frame = -2

Query: 300 SWKVLTYEEISKATSRFNKDNLVGKGGHSEVYKGILGEGELVAVKSLIRGDTGDQRTVDF 121
+W+ +Y+EIS AT+ F+ DN+ G+GG++EVYKGIL +G+ VAVK L +G +Q+ +F
Sbjct: 284 AWRCFSYQEISVATNDFHPDNMAGRGGYAEVYKGILSDGQCVAVKRLAQGKPTEQKEKEF 343

Query: 120 LTEIGMICHALHPNITPLVGYCIEKGLYLVYQFMRHGNLA 1
LTE+G+ H HPN L+G C+E GLYLV++F +G LA
Sbjct: 344 LTELGIQGHVCHPNTAYLLGCCVENGLYLVFEFCENGTLA 383


>tr|B8B8Q8|B8B8Q8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_28446 PE=4 SV=1
Length = 601

Score = 113 bits (282), Expect = 6e-24
Identities = 50/100 (50%), Positives = 73/100 (73%)
Frame = -2

Query: 300 SWKVLTYEEISKATSRFNKDNLVGKGGHSEVYKGILGEGELVAVKSLIRGDTGDQRTVDF 121
+W+ +Y+EIS AT+ F+ DN+ G+GG++EVYKGIL +G+ VAVK L +G +Q+ +F
Sbjct: 284 AWRCFSYQEISVATNDFHPDNMAGRGGYAEVYKGILSDGQCVAVKRLAQGKPTEQKEKEF 343

Query: 120 LTEIGMICHALHPNITPLVGYCIEKGLYLVYQFMRHGNLA 1
LTE+G+ H HPN L+G C+E GLYLV++F +G LA
Sbjct: 344 LTELGIQGHVCHPNTAYLLGCCVENGLYLVFEFCENGTLA 383


>tr|A3BR62|A3BR62_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_025534 PE=4 SV=1
Length = 688

Score = 113 bits (282), Expect = 6e-24
Identities = 50/100 (50%), Positives = 73/100 (73%)
Frame = -2

Query: 300 SWKVLTYEEISKATSRFNKDNLVGKGGHSEVYKGILGEGELVAVKSLIRGDTGDQRTVDF 121
+W+ +Y+EIS AT+ F+ DN+ G+GG++EVYKGIL +G+ VAVK L +G +Q+ +F
Sbjct: 284 AWRCFSYQEISVATNDFHPDNMAGRGGYAEVYKGILSDGQCVAVKRLAQGKPTEQKEKEF 343

Query: 120 LTEIGMICHALHPNITPLVGYCIEKGLYLVYQFMRHGNLA 1
LTE+G+ H HPN L+G C+E GLYLV++F +G LA
Sbjct: 344 LTELGIQGHVCHPNTAYLLGCCVENGLYLVFEFCENGTLA 383