BP916674
Clone id YMU001_000090_C06
Library
Length 524
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000090_C06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCCAGAGAGTATTGTTCGCTTTGGAACCCGGGTTGGCGGAAGGAGAGGAGTTCAGAAGTT
GGAAGTTCATGATGACAGAATCAAGTATGAAAGATTGCATCATGGATCAAGCTTCTTGGA
GCATTTGGAATTCTTATCTGCAGTTACAAGTAAAGGAGAGCGGCCGCCCATTGCAAGTCT
GTATGACGGCCTGCTCTCTGTTGCAGTAGGAATGGCGGCGCAAAGGTCCATTGAAACAGG
AAAACCTGTGAGCTTGGGAGACTATCTCGAGAAAAAGGCATGCCATTAAAAGATTTTGAG
AGGAGATTCCTCGGCAAGGAGCATCAACTGAGCATAAAGTTCGGTAATCTTCCGAAATGG
ATAGGTTGCTTATGGGGAGGGGAGGATTGTGGGATTGGTTTGTTGACTGTGTCTCCATCT
TCTCGTTTCGGGTTGGAGGAAGGCGCTCAAATGGGCTCCTCTCTTTGACATGCCCCACTC
TATTCATTCCATTCTTCTGTATTCTATTGTATTCCCCCTATTGA
■■Homology search results ■■ -
sp_hit_id Q6DKE2
Definition sp|Q6DKE2|DVL3_XENLA Segment polarity protein dishevelled homolog DVL-3 OS=Xenopus laevis
Align length 38
Score (bit) 32.3
E-value 1.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916674|Adiantum capillus-veneris mRNA, clone:
YMU001_000090_C06.
(524 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6DKE2|DVL3_XENLA Segment polarity protein dishevelled homolo... 32 1.4
sp|Q19542|DYHC2_CAEEL Cytoplasmic dynein 2 heavy chain 1 OS=Caen... 32 1.8
sp|Q28107|FA5_BOVIN Coagulation factor V OS=Bos taurus GN=F5 PE=... 31 3.1
sp|A9KL43|TRPC_CLOPH Indole-3-glycerol phosphate synthase OS=Clo... 31 4.1
sp|P23678|UN104_CAEEL Kinesin-like protein unc-104 OS=Caenorhabd... 30 5.3
sp|Q61062|DVL3_MOUSE Segment polarity protein dishevelled homolo... 30 5.3
sp|Q92997|DVL3_HUMAN Segment polarity protein dishevelled homolo... 30 5.3
sp|O55081|RBL2_RAT Retinoblastoma-like protein 2 OS=Rattus norve... 30 7.0
sp|B1WAP7|DVL3_XENTR Segment polarity protein dishevelled homolo... 30 7.0
sp|O88974|SETB1_MOUSE Histone-lysine N-methyltransferase SETDB1 ... 30 9.1

>sp|Q6DKE2|DVL3_XENLA Segment polarity protein dishevelled homolog
DVL-3 OS=Xenopus laevis GN=dvl3 PE=2 SV=1
Length = 717

Score = 32.3 bits (72), Expect = 1.4
Identities = 17/38 (44%), Positives = 20/38 (52%)
Frame = -3

Query: 246 GFPVSMDLCAAIPTATESRPSYRLAMGGRSPLLVTADK 133
G P S DL + P T SR S+R+AMG S V K
Sbjct: 675 GAPPSRDLASVPPELTASRQSFRMAMGNPSEFFVDVIK 712


>sp|Q19542|DYHC2_CAEEL Cytoplasmic dynein 2 heavy chain 1
OS=Caenorhabditis elegans GN=che-3 PE=2 SV=2
Length = 4171

Score = 32.0 bits (71), Expect = 1.8
Identities = 18/49 (36%), Positives = 24/49 (48%)
Frame = -2

Query: 415 ETQSTNQSHNPPLPISNLSISEDYRTLCSVDAPCRGISSQNLLMACLFL 269
E+ ST +P+ S SE +CSV+ PCRG N+ LFL
Sbjct: 4124 ESSSTITGEQIQVPV--YSSSERSDLICSVNMPCRGADQWNIAAVALFL 4170


>sp|Q28107|FA5_BOVIN Coagulation factor V OS=Bos taurus GN=F5 PE=1
SV=1
Length = 2211

Score = 31.2 bits (69), Expect = 3.1
Identities = 18/64 (28%), Positives = 34/64 (53%)
Frame = -2

Query: 499 QKNGMNRVGHVKERSPFERLPPTRNEKMETQSTNQSHNPPLPISNLSISEDYRTLCSVDA 320
+K+ +N E+ E +PP+ N +++ S+++SH L N +E +TL ++A
Sbjct: 751 EKDELNLTALALEKDS-EFIPPSANRSLDSNSSSRSHVSRLIAKN--FAESLKTLLHLEA 807

Query: 319 PCRG 308
P G
Sbjct: 808 PAAG 811


>sp|A9KL43|TRPC_CLOPH Indole-3-glycerol phosphate synthase
OS=Clostridium phytofermentans (strain ATCC 700394 / DSM
18823 / ISDg) GN=trpC PE=3 SV=1
Length = 271

Score = 30.8 bits (68), Expect = 4.1
Identities = 13/27 (48%), Positives = 18/27 (66%)
Frame = +1

Query: 247 CELGRLSREKGMPLKDFERRFLGKEHQ 327
CE+ R S KGM KDF+ F+ KE++
Sbjct: 65 CEIKRASPSKGMIAKDFDPVFIAKEYE 91


>sp|P23678|UN104_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis
elegans GN=unc-104 PE=2 SV=3
Length = 1584

Score = 30.4 bits (67), Expect = 5.3
Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 2/65 (3%)
Frame = -2

Query: 478 VGHVKERSPFERLPPTRNEKMETQSTNQSHNPPLPISNLSISEDYRTLCSVDAPCR--GI 305
+G ++ + P + PPT N+ E + S++ P+S+ S+ + R S D CR
Sbjct: 1359 LGLIRRKIPMNKDPPTGNKAQELSDESGSNSITSPVSDKSLIKSSR---SSDLLCRQKSK 1415

Query: 304 SSQNL 290
S QNL
Sbjct: 1416 SDQNL 1420


>sp|Q61062|DVL3_MOUSE Segment polarity protein dishevelled homolog
DVL-3 OS=Mus musculus GN=Dvl3 PE=1 SV=1
Length = 716

Score = 30.4 bits (67), Expect = 5.3
Identities = 15/34 (44%), Positives = 18/34 (52%)
Frame = -3

Query: 246 GFPVSMDLCAAIPTATESRPSYRLAMGGRSPLLV 145
G P DL + P T SR S+R+AMG S V
Sbjct: 680 GAPPGRDLASVPPELTASRQSFRMAMGNPSEFFV 713


>sp|Q92997|DVL3_HUMAN Segment polarity protein dishevelled homolog
DVL-3 OS=Homo sapiens GN=DVL3 PE=1 SV=2
Length = 716

Score = 30.4 bits (67), Expect = 5.3
Identities = 15/34 (44%), Positives = 18/34 (52%)
Frame = -3

Query: 246 GFPVSMDLCAAIPTATESRPSYRLAMGGRSPLLV 145
G P DL + P T SR S+R+AMG S V
Sbjct: 680 GAPPGRDLASVPPELTASRQSFRMAMGNPSEFFV 713


>sp|O55081|RBL2_RAT Retinoblastoma-like protein 2 OS=Rattus
norvegicus GN=Rbl2 PE=1 SV=1
Length = 1135

Score = 30.0 bits (66), Expect = 7.0
Identities = 15/37 (40%), Positives = 19/37 (51%)
Frame = -1

Query: 455 PI*APSSNPKREDGDTVNKPIPQSSPPHKQPIHFGRL 345
P A SS + EDGDT ++ P SP H+ F L
Sbjct: 13 PAAAASSEEEEEDGDTADRAQPAGSPSHQIQQRFEEL 49


>sp|B1WAP7|DVL3_XENTR Segment polarity protein dishevelled homolog
DVL-3 OS=Xenopus tropicalis GN=dvl3 PE=2 SV=1
Length = 713

Score = 30.0 bits (66), Expect = 7.0
Identities = 14/27 (51%), Positives = 17/27 (62%)
Frame = -3

Query: 246 GFPVSMDLCAAIPTATESRPSYRLAMG 166
G P S DL + P T SR S+R+AMG
Sbjct: 675 GAPPSRDLASVPPELTASRQSFRMAMG 701


>sp|O88974|SETB1_MOUSE Histone-lysine N-methyltransferase SETDB1
OS=Mus musculus GN=Setdb1 PE=1 SV=1
Length = 1307

Score = 29.6 bits (65), Expect = 9.1
Identities = 19/75 (25%), Positives = 32/75 (42%), Gaps = 9/75 (12%)
Frame = -2

Query: 517 GEYNRIQKNGMNRVGHVKERSPFERLPPTRNEK--METQSTNQSHNPPL-------PISN 365
GE R +G++ + P + P RN+ + S N HNPP+ P S
Sbjct: 1036 GEAERASTSGLSFKDEGDNKQPKKEDPENRNKMPVVTEGSQNHGHNPPMKSEGLRRPASK 1095

Query: 364 LSISEDYRTLCSVDA 320
+S+ + R + S +
Sbjct: 1096 MSVLQSQRVVTSTQS 1110


tr_hit_id A7R2C6
Definition tr|A7R2C6|A7R2C6_VITVI Chromosome undetermined scaffold_419, whole genome shotgun sequence OS=Vitis vinifera
Align length 85
Score (bit) 84.3
E-value 3.0e-15
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916674|Adiantum capillus-veneris mRNA, clone:
YMU001_000090_C06.
(524 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7R2C6|A7R2C6_VITVI Chromosome undetermined scaffold_419, who... 84 3e-15
tr|A9RK20|A9RK20_PHYPA Predicted protein OS=Physcomitrella paten... 82 2e-14
tr|B6T9L9|B6T9L9_MAIZE Putative uncharacterized protein OS=Zea m... 81 3e-14
tr|B4G075|B4G075_MAIZE Putative uncharacterized protein OS=Zea m... 81 3e-14
tr|B4FGK5|B4FGK5_MAIZE Putative uncharacterized protein OS=Zea m... 81 3e-14
tr|A2ZJU0|A2ZJU0_ORYSI Putative uncharacterized protein OS=Oryza... 79 1e-13
tr|Q69MP4|Q69MP4_ORYSJ Os08g0148200 protein OS=Oryza sativa subs... 78 2e-13
tr|A3BPL8|A3BPL8_ORYSJ Putative uncharacterized protein OS=Oryza... 78 2e-13
tr|Q66GR2|Q66GR2_ARATH At4g17370 OS=Arabidopsis thaliana GN=At4g... 73 8e-12
tr|O23580|O23580_ARATH Inositol 2-dehydrogenase like protein OS=... 73 8e-12
tr|Q2A9A9|Q2A9A9_BRAOL Oxidoreductase family protein OS=Brassica... 73 1e-11
tr|A0JWB2|A0JWB2_ARTS2 Oxidoreductase domain protein OS=Arthroba... 51 4e-05
tr|Q28R06|Q28R06_JANSC Oxidoreductase-like protein OS=Jannaschia... 50 7e-05
tr|Q0FGJ5|Q0FGJ5_9RHOB Myo-inositol-2-dehydrogenase OS=Rhodobact... 50 7e-05
tr|A3YGP3|A3YGP3_9GAMM Putative oxidoreductase myo-inositol 2-de... 50 9e-05
tr|A3JPV1|A3JPV1_9RHOB Oxidoreductase-like protein OS=Rhodobacte... 47 4e-04
tr|A9D840|A9D840_9RHIZ Oxidoreductase, putative OS=Hoeflea photo... 46 0.001
tr|A6VSP3|A6VSP3_MARMS Oxidoreductase domain protein OS=Marinomo... 46 0.001
tr|A0NM83|A0NM83_9RHOB Oxidoreductase-like protein OS=Labrenzia ... 45 0.002
tr|Q2NBV6|Q2NBV6_ERYLH Myo-inositol-2-dehydrogenase OS=Erythroba... 45 0.003
tr|A8LIZ7|A8LIZ7_DINSH Oxidoreductase domain protein OS=Dinorose... 45 0.003
tr|A9HUZ7|A9HUZ7_9RHOB Oxidoreductase, putative OS=Roseobacter l... 44 0.004
tr|A3V808|A3V808_9RHOB Putative oxidoreductase protein OS=Loktan... 44 0.005
tr|A4EJX6|A4EJX6_9RHOB Oxidoreductase, putative OS=Roseobacter s... 44 0.006
tr|A9FKZ9|A9FKZ9_9RHOB Oxidoreductase-like protein OS=Phaeobacte... 42 0.024
tr|Q167F5|Q167F5_ROSDO Oxidoreductase, putative OS=Roseobacter d... 41 0.032
tr|A9EM51|A9EM51_9RHOB Oxidoreductase-like protein OS=Phaeobacte... 41 0.032
tr|A0YGC2|A0YGC2_9GAMM Oxidoreductase-like protein OS=marine gam... 40 0.054
tr|B8H8E9|B8H8E9_9MICC Inositol 2-dehydrogenase OS=Arthrobacter ... 40 0.071
tr|B5JBI5|B5JBI5_9RHOB Oxidoreductase family, NAD-binding Rossma... 39 0.12

>tr|A7R2C6|A7R2C6_VITVI Chromosome undetermined scaffold_419, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00012967001 PE=4 SV=1
Length = 369

Score = 84.3 bits (207), Expect = 3e-15
Identities = 42/85 (49%), Positives = 56/85 (65%)
Frame = +2

Query: 2 PESIXXXXXXXXXXXXXQKLEVHDDRIKYERLHHGSSFLEHLEFLSAVTSKGERPPIASL 181
PESI Q ++ DDRIKY+ LHHGSS+LEH FL+AV +KG + P L
Sbjct: 278 PESIVRVGSREAGRDGVQTIKAKDDRIKYDGLHHGSSYLEHTHFLAAVRAKGLQAPAVDL 337

Query: 182 YDGLLSVAVGMAAQRSIETGKPVSL 256
DGL+SVA+G+AAQ SIE G+ +++
Sbjct: 338 QDGLVSVAIGVAAQLSIERGRFITI 362


>tr|A9RK20|A9RK20_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_203189 PE=4 SV=1
Length = 375

Score = 82.0 bits (201), Expect = 2e-14
Identities = 40/72 (55%), Positives = 53/72 (73%)
Frame = +2

Query: 53 QKLEVHDDRIKYERLHHGSSFLEHLEFLSAVTSKGERPPIASLYDGLLSVAVGMAAQRSI 232
Q EVHD+R+++E LHHGSS+LEH+EF AV S G RPP L GL+SVAVG+AAQ+SI
Sbjct: 300 QCYEVHDERVRFEGLHHGSSYLEHMEFAIAVHSHGSRPPAVGLEAGLMSVAVGVAAQQSI 359

Query: 233 ETGKPVSLGDYL 268
G+ V + + +
Sbjct: 360 LKGRFVFIKEVI 371


>tr|B6T9L9|B6T9L9_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 381

Score = 81.3 bits (199), Expect = 3e-14
Identities = 43/89 (48%), Positives = 56/89 (62%)
Frame = +2

Query: 2 PESIXXXXXXXXXXXXXQKLEVHDDRIKYERLHHGSSFLEHLEFLSAVTSKGERPPIASL 181
PESI + D+RIKY+ LHHGSS+LEHL FLSA+ ++G P +L
Sbjct: 291 PESIVRFGKRTEGRDGVVTIMAEDERIKYQGLHHGSSYLEHLNFLSAIRAQGASGPSVNL 350

Query: 182 YDGLLSVAVGMAAQRSIETGKPVSLGDYL 268
DGLLSVAVG+A Q SIE G+ V++ + L
Sbjct: 351 SDGLLSVAVGVAGQLSIEQGRFVTMEEVL 379


>tr|B4G075|B4G075_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 285

Score = 81.3 bits (199), Expect = 3e-14
Identities = 43/89 (48%), Positives = 56/89 (62%)
Frame = +2

Query: 2 PESIXXXXXXXXXXXXXQKLEVHDDRIKYERLHHGSSFLEHLEFLSAVTSKGERPPIASL 181
PESI + D+RIKY+ LHHGSS+LEHL FLSA+ ++G P +L
Sbjct: 195 PESIVRFGKRTEGRDGVVTIMAEDERIKYQGLHHGSSYLEHLNFLSAIRAQGASGPSVNL 254

Query: 182 YDGLLSVAVGMAAQRSIETGKPVSLGDYL 268
DGLLSVAVG+A Q SIE G+ V++ + L
Sbjct: 255 SDGLLSVAVGVAGQLSIEQGRFVTMEEVL 283


>tr|B4FGK5|B4FGK5_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 347

Score = 81.3 bits (199), Expect = 3e-14
Identities = 43/89 (48%), Positives = 56/89 (62%)
Frame = +2

Query: 2 PESIXXXXXXXXXXXXXQKLEVHDDRIKYERLHHGSSFLEHLEFLSAVTSKGERPPIASL 181
PESI + D+RIKY+ LHHGSS+LEHL FLSA+ ++G P +L
Sbjct: 257 PESIVRFGKRTEGRDGVVTIMAEDERIKYQGLHHGSSYLEHLNFLSAIRAQGASGPSVNL 316

Query: 182 YDGLLSVAVGMAAQRSIETGKPVSLGDYL 268
DGLLSVAVG+A Q SIE G+ V++ + L
Sbjct: 317 SDGLLSVAVGVAGQLSIEQGRFVTMEEVL 345


>tr|A2ZJU0|A2ZJU0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_38087 PE=4 SV=1
Length = 425

Score = 79.3 bits (194), Expect = 1e-13
Identities = 42/89 (47%), Positives = 54/89 (60%)
Frame = +2

Query: 2 PESIXXXXXXXXXXXXXQKLEVHDDRIKYERLHHGSSFLEHLEFLSAVTSKGERPPIASL 181
PESI + D+RIKY+ LHHGSS+LEHL FLSA+ +G P L
Sbjct: 335 PESIVRVGKRTGGRDGVVTIMAEDERIKYQGLHHGSSYLEHLNFLSAIRLQGASGPSVDL 394

Query: 182 YDGLLSVAVGMAAQRSIETGKPVSLGDYL 268
DGLLSVA+G+A Q SIE G+ V++ + L
Sbjct: 395 TDGLLSVAIGVAGQLSIEKGRFVTIEEVL 423


>tr|Q69MP4|Q69MP4_ORYSJ Os08g0148200 protein OS=Oryza sativa subsp.
japonica GN=P0470H09.37 PE=4 SV=1
Length = 845

Score = 78.2 bits (191), Expect = 2e-13
Identities = 41/85 (48%), Positives = 52/85 (61%)
Frame = +2

Query: 2 PESIXXXXXXXXXXXXXQKLEVHDDRIKYERLHHGSSFLEHLEFLSAVTSKGERPPIASL 181
PESI + D+RIKY+ LHHGSS+LEHL FLSA+ +G P L
Sbjct: 335 PESIVRVGKRTGGRDGVVTIMAEDERIKYQGLHHGSSYLEHLNFLSAIRLQGASGPSVDL 394

Query: 182 YDGLLSVAVGMAAQRSIETGKPVSL 256
DGLLSVA+G+A Q SIE G+ V++
Sbjct: 395 TDGLLSVAIGVAGQLSIEKGRFVTI 419


>tr|A3BPL8|A3BPL8_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_024990 PE=4 SV=1
Length = 448

Score = 78.2 bits (191), Expect = 2e-13
Identities = 41/85 (48%), Positives = 52/85 (61%)
Frame = +2

Query: 2 PESIXXXXXXXXXXXXXQKLEVHDDRIKYERLHHGSSFLEHLEFLSAVTSKGERPPIASL 181
PESI + D+RIKY+ LHHGSS+LEHL FLSA+ +G P L
Sbjct: 272 PESIVRVGKRTGGRDGVVTIMAEDERIKYQGLHHGSSYLEHLNFLSAIRLQGASGPSVDL 331

Query: 182 YDGLLSVAVGMAAQRSIETGKPVSL 256
DGLLSVA+G+A Q SIE G+ V++
Sbjct: 332 TDGLLSVAIGVAGQLSIEKGRFVTI 356


>tr|Q66GR2|Q66GR2_ARATH At4g17370 OS=Arabidopsis thaliana
GN=At4g17370 PE=2 SV=1
Length = 368

Score = 73.2 bits (178), Expect = 8e-12
Identities = 40/89 (44%), Positives = 55/89 (61%)
Frame = +2

Query: 2 PESIXXXXXXXXXXXXXQKLEVHDDRIKYERLHHGSSFLEHLEFLSAVTSKGERPPIASL 181
PE I Q ++ D+RIKYE LHHGSS+LEHL FLSA+ +GE L
Sbjct: 282 PEGIVRSGSRIGGREHVQTIKAEDERIKYEGLHHGSSYLEHLTFLSAI--RGEGIAAVDL 339

Query: 182 YDGLLSVAVGMAAQRSIETGKPVSLGDYL 268
DGL++VA+G+AAQ SI+ + V++ + L
Sbjct: 340 EDGLMAVAMGVAAQLSIQERRYVTIDEVL 368


>tr|O23580|O23580_ARATH Inositol 2-dehydrogenase like protein
OS=Arabidopsis thaliana GN=dl4720w PE=2 SV=1
Length = 364

Score = 73.2 bits (178), Expect = 8e-12
Identities = 40/89 (44%), Positives = 55/89 (61%)
Frame = +2

Query: 2 PESIXXXXXXXXXXXXXQKLEVHDDRIKYERLHHGSSFLEHLEFLSAVTSKGERPPIASL 181
PE I Q ++ D+RIKYE LHHGSS+LEHL FLSA+ +GE L
Sbjct: 278 PEGIVRSGSRIGGREHVQTIKAEDERIKYEGLHHGSSYLEHLTFLSAI--RGEGIAAVDL 335

Query: 182 YDGLLSVAVGMAAQRSIETGKPVSLGDYL 268
DGL++VA+G+AAQ SI+ + V++ + L
Sbjct: 336 EDGLMAVAMGVAAQLSIQERRYVTIDEVL 364