BP916683
Clone id YMU001_000090_D03
Library
Length 471
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000090_D03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATTCGCGGCCGCGAATTCTTATTCACATACATGTCCACCAGCATGTTTCCCACAAAGGCT
TCCCCTTCATAACCACATTTATAAATCACATTATTTAGTTCTCTTCCGATCTCTGATGCA
CCAGCATAACCGCAAGCTTTTAAGCTGCACACGAGACTGATGGCGTCAGGCAGCACACCA
TCTATTTGCATTTGTTCAAAGCAAGCCAAAGCTTCCTCGCCCAAGCCTTGCTCTGTGTAT
CCCCTTATTAGCGTCGTCCAAGTGACAACATCCCGCACTTGCATTTCATCAAAAACCTCA
CGAACCTCTACAAGCGAGCCACATTTTGCATAAAAGTCCACTACTGCACTTGCCACAACA
TGATCTTTGATACGGCCCATTTCTTTCAGTTCTGCATGTAGTTGTCGACCGCTGTCCAGA
GCTCCTATGCTGCTACAAGCTTTCAAGCCACAGACAAAGGCAAAATTATCT
■■Homology search results ■■ -
sp_hit_id Q9SN39
Definition sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protein At4g18750, chloroplastic OS=Arabidopsis thaliana
Align length 148
Score (bit) 108.0
E-value 1.0e-23
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916683|Adiantum capillus-veneris mRNA, clone:
YMU001_000090_D03.
(451 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protei... 108 1e-23
sp|Q0WNP3|PP319_ARATH Pentatricopeptide repeat-containing protei... 105 1e-22
sp|Q9LUJ2|PP249_ARATH Pentatricopeptide repeat-containing protei... 104 2e-22
sp|Q9FXB9|PPR84_ARATH Pentatricopeptide repeat-containing protei... 103 3e-22
sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protei... 103 3e-22
sp|Q9SR82|PP219_ARATH Putative pentatricopeptide repeat-containi... 103 4e-22
sp|P93005|PP181_ARATH Pentatricopeptide repeat-containing protei... 103 4e-22
sp|Q9CAY1|PP223_ARATH Putative pentatricopeptide repeat-containi... 102 1e-21
sp|Q9LTF4|PP429_ARATH Putative pentatricopeptide repeat-containi... 101 2e-21
sp|Q9SMZ2|PP347_ARATH Pentatricopeptide repeat-containing protei... 101 2e-21
sp|Q9SUH6|PP341_ARATH Pentatricopeptide repeat-containing protei... 101 2e-21
sp|Q9LFI1|PP280_ARATH Pentatricopeptide repeat-containing protei... 101 2e-21
sp|P93011|PP182_ARATH Pentatricopeptide repeat-containing protei... 101 2e-21
sp|Q9FHF9|PP419_ARATH Pentatricopeptide repeat-containing protei... 100 2e-21
sp|Q9LW32|PP258_ARATH Pentatricopeptide repeat-containing protei... 100 2e-21
sp|Q9SZK1|PP355_ARATH Pentatricopeptide repeat-containing protei... 100 3e-21
sp|P0C899|PP271_ARATH Putative pentatricopeptide repeat-containi... 100 4e-21
sp|Q9LFL5|PP390_ARATH Putative pentatricopeptide repeat-containi... 100 5e-21
sp|O23266|PP308_ARATH Pentatricopeptide repeat-containing protei... 100 5e-21
sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protei... 99 1e-20
sp|Q9LIQ7|PP252_ARATH Pentatricopeptide repeat-containing protei... 98 1e-20
sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protei... 98 2e-20
sp|O04659|PP398_ARATH Pentatricopeptide repeat-containing protei... 98 2e-20
sp|Q9M9E2|PPR45_ARATH Pentatricopeptide repeat-containing protei... 97 2e-20
sp|O23337|PP311_ARATH Pentatricopeptide repeat-containing protei... 97 3e-20
sp|Q9SS60|PP210_ARATH Pentatricopeptide repeat-containing protei... 97 3e-20
sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protei... 97 4e-20
sp|Q9LIE7|PP246_ARATH Pentatricopeptide repeat-containing protei... 97 4e-20
sp|Q9LNP2|PPR47_ARATH Putative pentatricopeptide repeat-containi... 96 5e-20
sp|Q9ZQ74|PP146_ARATH Pentatricopeptide repeat-containing protei... 96 5e-20

>sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protein
At4g18750, chloroplastic OS=Arabidopsis thaliana
GN=PCMP-H45 PE=2 SV=1
Length = 871

Score = 108 bits (270), Expect = 1e-23
Identities = 56/148 (37%), Positives = 85/148 (57%), Gaps = 1/148 (0%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D C L AC+S+ A D GR++H + G D VA+++VD YAKCG+L+ +F
Sbjct: 498 DERTVACVLPACASLSAFDKGREIHGYIMRNGYFSDRHVANSLVDMYAKCGALLLAHMLF 557

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
D++ +D+V+WT +I GY G G+EA+A F QM+ G+ D IS V L AC ++G +
Sbjct: 558 DDIASKDLVSWTVMIAGYGMHGFGKEAIALFNQMRQAGIEADEISFVSLLYACSHSGLVD 617

Query: 90 IGRELNNVI-YKCGYEGEAFVGNMLVDM 10
G N++ ++C E +VDM
Sbjct: 618 EGWRFFNIMRHECKIEPTVEHYACIVDM 645



Score = 104 bits (260), Expect = 2e-22
Identities = 55/149 (36%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D + L C+ LD G+++H +KE D V++A++D YAKCGS+ E VF
Sbjct: 396 DVYTVTAVLNCCARYRLLDEGKRVHEWIKENDLGFDIFVSNALMDMYAKCGSMQEAELVF 455

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFE-QMQIDGVLPDAISLVCSLKACGYAGAS 94
EM+V+D+++W T+I GY++ EAL+ F ++ PD ++ C L AC A
Sbjct: 456 SEMRVKDIISWNTIIGGYSKNCYANEALSLFNLLLEEKRFSPDERTVACVLPACASLSAF 515

Query: 93 EIGRELNNVIYKCGYEGEAFVGNMLVDMY 7
+ GRE++ I + GY + V N LVDMY
Sbjct: 516 DKGREIHGYIMRNGYFSDRHVANSLVDMY 544



Score = 94.0 bits (232), Expect = 3e-19
Identities = 49/148 (33%), Positives = 82/148 (55%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D++ F C K+ SS+ ++ G QLH + + G + + V +++V FY K + R+VF
Sbjct: 194 DSYTFSCVSKSFSSLRSVHGGEQLHGFILKSGFGERNSVGNSLVAFYLKNQRVDSARKVF 253

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
DEM RDV++W ++I GY GL E+ L+ F QM + G+ D ++V C +
Sbjct: 254 DEMTERDVISWNSIINGYVSNGLAEKGLSVFVQMLVSGIEIDLATIVSVFAGCADSRLIS 313

Query: 90 IGRELNNVIYKCGYEGEAFVGNMLVDMY 7
+GR ++++ K + E N L+DMY
Sbjct: 314 LGRAVHSIGVKACFSREDRFCNTLLDMY 341



Score = 81.3 bits (199), Expect = 2e-15
Identities = 42/137 (30%), Positives = 73/137 (53%)
Frame = -2

Query: 417 CSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQVRDVVTW 238
C+ + GR +H+ + ++ + ++D Y+KCG L + VF EM R VV++
Sbjct: 306 CADSRLISLGRAVHSIGVKACFSREDRFCNTLLDMYSKCGDLDSAKAVFREMSDRSVVSY 365

Query: 237 TTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIGRELNNVIYK 58
T++I GY +GL EA+ FE+M+ +G+ PD ++ L C + G+ ++ I +
Sbjct: 366 TSMIAGYAREGLAGEAVKLFEEMEEEGISPDVYTVTAVLNCCARYRLLDEGKRVHEWIKE 425

Query: 57 CGYEGEAFVGNMLVDMY 7
+ FV N L+DMY
Sbjct: 426 NDLGFDIFVSNALMDMY 442



Score = 64.7 bits (156), Expect = 2e-10
Identities = 37/141 (26%), Positives = 66/141 (46%)
Frame = -2

Query: 426 LKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQVRDV 247
L+ C+ +L G+++ ++ G + D + S + Y CG L E VFDE+++
Sbjct: 101 LQLCADSKSLKDGKEVDNFIRGNGFVIDSNLGSKLSLMYTNCGDLKEASRVFDEVKIEKA 160

Query: 246 VTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIGRELNNV 67
+ W L+ + G ++ F++M GV D+ + C K+ + G +L+
Sbjct: 161 LFWNILMNELAKSGDFSGSIGLFKKMMSSGVEMDSYTFSCVSKSFSSLRSVHGGEQLHGF 220

Query: 66 IYKCGYEGEAFVGNMLVDMYV 4
I K G+ VGN LV Y+
Sbjct: 221 ILKSGFGERNSVGNSLVAFYL 241


>sp|Q0WNP3|PP319_ARATH Pentatricopeptide repeat-containing protein
At4g18520 OS=Arabidopsis thaliana GN=PCMP-A2 PE=2 SV=1
Length = 617

Score = 105 bits (261), Expect = 1e-22
Identities = 56/144 (38%), Positives = 89/144 (61%), Gaps = 1/144 (0%)
Frame = -2

Query: 435 VCG-LKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQ 259
VC LKACS AL GRQ+H+ + + D V ++++D YAKCG + + R+VFD M
Sbjct: 287 VCSILKACSEEKALRFGRQVHSLVVKRMIKTDVFVGTSLMDMYAKCGEISDCRKVFDGMS 346

Query: 258 VRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIGRE 79
R+ VTWT++I + +G GEEA++ F M+ ++ + +++V L+ACG GA +G+E
Sbjct: 347 NRNTVTWTSIIAAHAREGFGEEAISLFRIMKRRHLIANNLTVVSILRACGSVGALLLGKE 406

Query: 78 LNNVIYKCGYEGEAFVGNMLVDMY 7
L+ I K E ++G+ LV +Y
Sbjct: 407 LHAQIIKNSIEKNVYIGSTLVWLY 430



Score = 96.3 bits (238), Expect = 5e-20
Identities = 50/144 (34%), Positives = 82/144 (56%)
Frame = -2

Query: 438 FVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQ 259
FVC L CS + GRQ+H + ++G + + +V S++V FYA+CG L FD M+
Sbjct: 187 FVCLLNLCSRRAEFELGRQVHGNMVKVG-VGNLIVESSLVYFYAQCGELTSALRAFDMME 245

Query: 258 VRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIGRE 79
+DV++WT +I + +G G +A+ F M LP+ ++ LKAC A GR+
Sbjct: 246 EKDVISWTAVISACSRKGHGIKAIGMFIGMLNHWFLPNEFTVCSILKACSEEKALRFGRQ 305

Query: 78 LNNVIYKCGYEGEAFVGNMLVDMY 7
+++++ K + + FVG L+DMY
Sbjct: 306 VHSLVVKRMIKTDVFVGTSLMDMY 329



Score = 92.4 bits (228), Expect = 8e-19
Identities = 51/148 (34%), Positives = 82/148 (55%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
+N V L+AC S+GAL G++LHA++ + K+ + S +V Y KCG + V
Sbjct: 384 NNLTVVSILRACGSVGALLLGKELHAQIIKNSIEKNVYIGSTLVWLYCKCGESRDAFNVL 443

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
++ RDVV+WT +I G + G EAL ++M +GV P+ + +LKAC + +
Sbjct: 444 QQLPSRDVVSWTAMISGCSSLGHESEALDFLKEMIQEGVEPNPFTYSSALKACANSESLL 503

Query: 90 IGRELNNVIYKCGYEGEAFVGNMLVDMY 7
IGR ++++ K FVG+ L+ MY
Sbjct: 504 IGRSIHSIAKKNHALSNVFVGSALIHMY 531



Score = 74.3 bits (181), Expect = 2e-13
Identities = 38/112 (33%), Positives = 58/112 (51%)
Frame = -2

Query: 444 FAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDE 265
F + LKAC++ +L GR +H+ K+ + + V SA++ YAKCG + E VFD
Sbjct: 487 FTYSSALKACANSESLLIGRSIHSIAKKNHALSNVFVGSALIHMYAKCGFVSEAFRVFDS 546

Query: 264 MQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACG 109
M +++V+W +I GY G EAL +M+ +G D L CG
Sbjct: 547 MPEKNLVSWKAMIMGYARNGFCREALKLMYRMEAEGFEVDDYIFATILSTCG 598



Score = 63.9 bits (154), Expect = 3e-10
Identities = 36/99 (36%), Positives = 53/99 (53%), Gaps = 1/99 (1%)
Frame = -2

Query: 306 KCGSLVEVREVFDEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGV-LPDAISLV 130
+ G LV R+VFD M ++ VTWT +I GY + GL +EA A FE G+ + V
Sbjct: 129 RLGDLVYARKVFDSMPEKNTVTWTAMIDGYLKYGLEDEAFALFEDYVKHGIRFTNERMFV 188

Query: 129 CSLKACGYAGASEIGRELNNVIYKCGYEGEAFVGNMLVD 13
C L C E+GR+++ + K G VGN++V+
Sbjct: 189 CLLNLCSRRAEFELGRQVHGNMVKVG------VGNLIVE 221


>sp|Q9LUJ2|PP249_ARATH Pentatricopeptide repeat-containing protein
At3g22690 OS=Arabidopsis thaliana GN=PCMP-H56 PE=2 SV=1
Length = 842

Score = 104 bits (259), Expect = 2e-22
Identities = 56/150 (37%), Positives = 87/150 (58%), Gaps = 1/150 (0%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D + F GL AC+ A +G Q+H + +MG KD V +++V FYA+CG L R+VF
Sbjct: 133 DKYTFPFGLSACAKSRAKGNGIQIHGLIVKMGYAKDLFVQNSLVHFYAECGELDSARKVF 192

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQID-GVLPDAISLVCSLKACGYAGAS 94
DEM R+VV+WT++I GY + ++A+ F +M D V P+++++VC + AC
Sbjct: 193 DEMSERNVVSWTSMICGYARRDFAKDAVDLFFRMVRDEEVTPNSVTMVCVISACAKLEDL 252

Query: 93 EIGRELNNVIYKCGYEGEAFVGNMLVDMYV 4
E G ++ I G E + + LVDMY+
Sbjct: 253 ETGEKVYAFIRNSGIEVNDLMVSALVDMYM 282



Score = 84.3 bits (207), Expect = 2e-16
Identities = 42/149 (28%), Positives = 78/149 (52%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
++ VC + AC+ + L++G +++A ++ G + ++ SA+VD Y KC ++ + +F
Sbjct: 235 NSVTMVCVISACAKLEDLETGEKVYAFIRNSGIEVNDLMVSALVDMYMKCNAIDVAKRLF 294

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
DE ++ + Y QGL EAL F M GV PD IS++ ++ +C
Sbjct: 295 DEYGASNLDLCNAMASNYVRQGLTREALGVFNLMMDSGVRPDRISMLSAISSCSQLRNIL 354

Query: 90 IGRELNNVIYKCGYEGEAFVGNMLVDMYV 4
G+ + + + G+E + N L+DMY+
Sbjct: 355 WGKSCHGYVLRNGFESWDNICNALIDMYM 383



Score = 70.9 bits (172), Expect = 2e-12
Identities = 34/115 (29%), Positives = 60/115 (52%)
Frame = -2

Query: 420 ACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQVRDVVT 241
AC +GALD + ++ +++ G D + + +VD +++CG +F+ + RDV
Sbjct: 479 ACGHLGALDLAKWIYYYIEKNGIQLDVRLGTTLVDMFSRCGDPESAMSIFNSLTNRDVSA 538

Query: 240 WTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIGREL 76
WT I G E A+ F+ M G+ PD ++ V +L AC + G + G+E+
Sbjct: 539 WTAAIGAMAMAGNAERAIELFDDMIEQGLKPDGVAFVGALTACSHGGLVQQGKEI 593



Score = 68.2 bits (165), Expect = 2e-11
Identities = 45/180 (25%), Positives = 77/180 (42%), Gaps = 32/180 (17%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D + + + +CS + + G+ H + G + +A++D Y KC +F
Sbjct: 336 DRISMLSAISSCSQLRNILWGKSCHGYVLRNGFESWDNICNALIDMYMKCHRQDTAFRIF 395

Query: 270 DEMQVRDVVTWTTLIRGYTEQG-------------------------------LGEEALA 184
D M + VVTW +++ GY E G L EEA+
Sbjct: 396 DRMSNKTVVTWNSIVAGYVENGEVDAAWETFETMPEKNIVSWNTIISGLVQGSLFEEAIE 455

Query: 183 CFEQMQI-DGVLPDAISLVCSLKACGYAGASEIGRELNNVIYKCGYEGEAFVGNMLVDMY 7
F MQ +GV D ++++ ACG+ GA ++ + + I K G + + +G LVDM+
Sbjct: 456 VFCSMQSQEGVNADGVTMMSIASACGHLGALDLAKWIYYYIEKNGIQLDVRLGTTLVDMF 515



Score = 62.4 bits (150), Expect = 9e-10
Identities = 45/144 (31%), Positives = 66/144 (45%), Gaps = 4/144 (2%)
Frame = -2

Query: 426 LKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCG---SLVEVREVFDEMQV 256
LK C +I L + H L + G D + +V + G SL +EVF+ +
Sbjct: 39 LKNCKTIDEL---KMFHRSLTKQGLDNDVSTITKLVARSCELGTRESLSFAKEVFENSES 95

Query: 255 RDVV-TWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIGRE 79
+ +LIRGY GL EA+ F +M G+ PD + L AC + A G +
Sbjct: 96 YGTCFMYNSLIRGYASSGLCNEAILLFLRMMNSGISPDKYTFPFGLSACAKSRAKGNGIQ 155

Query: 78 LNNVIYKCGYEGEAFVGNMLVDMY 7
++ +I K GY + FV N LV Y
Sbjct: 156 IHGLIVKMGYAKDLFVQNSLVHFY 179



Score = 42.0 bits (97), Expect = 0.001
Identities = 29/98 (29%), Positives = 49/98 (50%), Gaps = 2/98 (2%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQL-HAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREV 274
D AFV L ACS G + G+++ ++ LK G + V +VD + G L E ++
Sbjct: 570 DGVAFVGALTACSHGGLVQQGKEIFYSMLKLHGVSPEDVHYGCMVDLLGRAGLLEEAVQL 629

Query: 273 FDEMQVR-DVVTWTTLIRGYTEQGLGEEALACFEQMQI 163
++M + + V W +L+ QG E A E++Q+
Sbjct: 630 IEDMPMEPNDVIWNSLLAACRVQGNVEMAAYAAEKIQV 667


>sp|Q9FXB9|PPR84_ARATH Pentatricopeptide repeat-containing protein
At1g56690, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-H69 PE=2 SV=1
Length = 704

Score = 103 bits (257), Expect = 3e-22
Identities = 48/117 (41%), Positives = 69/117 (58%)
Frame = -2

Query: 426 LKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQVRDV 247
L C+++ +L GRQ+HA L D VAS ++ Y KCG LV+ + VFD +D+
Sbjct: 338 LSVCATLASLQYGRQVHAHLVRCQFDDDVYVASVLMTMYVKCGELVKAKLVFDRFSSKDI 397

Query: 246 VTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIGREL 76
+ W ++I GY GLGEEAL F +M G +P+ ++L+ L AC YAG E G E+
Sbjct: 398 IMWNSIISGYASHGLGEEALKIFHEMPSSGTMPNKVTLIAILTACSYAGKLEEGLEI 454



Score = 78.2 bits (191), Expect = 2e-14
Identities = 44/136 (32%), Positives = 74/136 (54%), Gaps = 1/136 (0%)
Frame = -2

Query: 408 IGALDSGRQLHAE-LKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQVRDVVTWTT 232
+G SGR AE E+ +K + +A++ + + G + + R VFD M+ RD TW
Sbjct: 242 LGYTLSGRIEDAEEFFEVMPMKPVIACNAMIVGFGEVGEISKARRVFDLMEDRDNATWRG 301

Query: 231 LIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIGRELNNVIYKCG 52
+I+ Y +G EAL F QMQ GV P SL+ L C + + GR+++ + +C
Sbjct: 302 MIKAYERKGFELEALDLFAQMQKQGVRPSFPSLISILSVCATLASLQYGRQVHAHLVRCQ 361

Query: 51 YEGEAFVGNMLVDMYV 4
++ + +V ++L+ MYV
Sbjct: 362 FDDDVYVASVLMTMYV 377



Score = 53.5 bits (127), Expect = 4e-07
Identities = 31/80 (38%), Positives = 47/80 (58%), Gaps = 1/80 (1%)
Frame = -2

Query: 405 GALDSGRQLHA-ELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQVRDVVTWTTL 229
G +D GR A +L +M +KD V ++ ++ + G + E R +FDEM+ R+VVTWTT+
Sbjct: 150 GLIDDGRIDKARKLYDMMPVKDVVASTNMIGGLCREGRVDEARLIFDEMRERNVVTWTTM 209

Query: 228 IRGYTEQGLGEEALACFEQM 169
I GY + + A FE M
Sbjct: 210 ITGYRQNNRVDVARKLFEVM 229



Score = 49.3 bits (116), Expect = 8e-06
Identities = 29/81 (35%), Positives = 46/81 (56%)
Frame = -2

Query: 411 SIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQVRDVVTWTT 232
S G RQL E+ E ++ V + +V Y K +VE R VF+ M R+VV+WT
Sbjct: 60 SNGLPKEARQLFDEMSE----RNVVSWNGLVSGYIKNRMIVEARNVFELMPERNVVSWTA 115

Query: 231 LIRGYTEQGLGEEALACFEQM 169
+++GY ++G+ EA + F +M
Sbjct: 116 MVKGYMQEGMVGEAESLFWRM 136



Score = 41.2 bits (95), Expect = 0.002
Identities = 21/54 (38%), Positives = 31/54 (57%)
Frame = -2

Query: 330 SAVVDFYAKCGSLVEVREVFDEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQM 169
+++V Y G E R++FDEM R+VV+W L+ GY + + EA FE M
Sbjct: 52 NSIVSGYFSNGLPKEARQLFDEMSERNVVSWNGLVSGYIKNRMIVEARNVFELM 105



Score = 40.0 bits (92), Expect = 0.005
Identities = 15/47 (31%), Positives = 29/47 (61%)
Frame = -2

Query: 309 AKCGSLVEVREVFDEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQM 169
++ G + E R+ FD +Q + + +W +++ GY GL +EA F++M
Sbjct: 28 SRIGKINEARKFFDSLQFKAIGSWNSIVSGYFSNGLPKEARQLFDEM 74


>sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protein
At3g09040, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E88 PE=2 SV=1
Length = 1028

Score = 103 bits (257), Expect = 3e-22
Identities = 51/148 (34%), Positives = 84/148 (56%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D+F F L C++ L+ G Q H+ + + K+ V +A+VD YAKCG+L + R++F
Sbjct: 427 DDFTFTSLLSTCAASHDLEMGSQFHSIIIKKKLAKNLFVGNALVDMYAKCGALEDARQIF 486

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
+ M RD VTW T+I Y + EA F++M + G++ D L +LKAC +
Sbjct: 487 ERMCDRDNVTWNTIIGSYVQDENESEAFDLFKRMNLCGIVSDGACLASTLKACTHVHGLY 546

Query: 90 IGRELNNVIYKCGYEGEAFVGNMLVDMY 7
G++++ + KCG + + G+ L+DMY
Sbjct: 547 QGKQVHCLSVKCGLDRDLHTGSSLIDMY 574



Score = 95.1 bits (235), Expect = 1e-19
Identities = 46/126 (36%), Positives = 75/126 (59%), Gaps = 1/126 (0%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D FV L+ CS + +L GR +H+ + + D + ++ ++D YAKCG + +VF
Sbjct: 731 DQATFVTVLRVCSVLSSLREGRAIHSLIFHLAHDLDELTSNTLIDMYAKCGDMKGSSQVF 790

Query: 270 DEMQVR-DVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGAS 94
DEM+ R +VV+W +LI GY + G E+AL F+ M+ ++PD I+ + L AC +AG
Sbjct: 791 DEMRRRSNVVSWNSLINGYAKNGYAEDALKIFDSMRQSHIMPDEITFLGVLTACSHAGKV 850

Query: 93 EIGREL 76
GR++
Sbjct: 851 SDGRKI 856



Score = 85.1 bits (209), Expect = 1e-16
Identities = 48/151 (31%), Positives = 80/151 (52%), Gaps = 1/151 (0%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D LKAC+ + L G+Q+H + G +D S+++D Y+KCG + + R+VF
Sbjct: 528 DGACLASTLKACTHVHGLYQGKQVHCLSVKCGLDRDLHTGSSLIDMYSKCGIIKDARKVF 587

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
+ VV+ LI GY++ L EEA+ F++M GV P I+ ++AC +
Sbjct: 588 SSLPEWSVVSMNALIAGYSQNNL-EEAVVLFQEMLTRGVNPSEITFATIVEACHKPESLT 646

Query: 90 IGRELNNVIYKCGYEGEA-FVGNMLVDMYVN 1
+G + + I K G+ E ++G L+ MY+N
Sbjct: 647 LGTQFHGQITKRGFSSEGEYLGISLLGMYMN 677



Score = 80.9 bits (198), Expect = 2e-15
Identities = 43/140 (30%), Positives = 69/140 (49%)
Frame = -2

Query: 426 LKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQVRDV 247
L A + LD G +HAE ++G + V S++V Y+KC + +VF+ ++ ++
Sbjct: 334 LSAIGIVANLDLGLVVHAEAIKLGLASNIYVGSSLVSMYSKCEKMEAAAKVFEALEEKND 393

Query: 246 VTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIGRELNNV 67
V W +IRGY G + + F M+ G D + L C + E+G + +++
Sbjct: 394 VFWNAMIRGYAHNGESHKVMELFMDMKSSGYNIDDFTFTSLLSTCAASHDLEMGSQFHSI 453

Query: 66 IYKCGYEGEAFVGNMLVDMY 7
I K FVGN LVDMY
Sbjct: 454 IIKKKLAKNLFVGNALVDMY 473



Score = 76.3 bits (186), Expect = 6e-14
Identities = 38/107 (35%), Positives = 60/107 (56%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
+ F F L C+ ++ GRQ+H + +MG ++ A+VD YAKC + + R VF
Sbjct: 159 NKFTFSIVLSTCARETNVEFGRQIHCSMIKMGLERNSYCGGALVDMYAKCDRISDARRVF 218

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLV 130
+ + + V WT L GY + GL EEA+ FE+M+ +G PD ++ V
Sbjct: 219 EWIVDPNTVCWTCLFSGYVKAGLPEEAVLVFERMRDEGHRPDHLAFV 265



Score = 75.9 bits (185), Expect = 8e-14
Identities = 39/146 (26%), Positives = 76/146 (52%), Gaps = 2/146 (1%)
Frame = -2

Query: 438 FVCGLKACSSIGALDSGRQLHAELKEMGRIKD-HVVASAVVDFYAKCGSLVEVREVFDEM 262
F ++AC +L G Q H ++ + G + + +++ Y + E +F E+
Sbjct: 632 FATIVEACHKPESLTLGTQFHGQITKRGFSSEGEYLGISLLGMYMNSRGMTEACALFSEL 691

Query: 261 QV-RDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIG 85
+ +V WT ++ G+++ G EEAL +++M+ DGVLPD + V L+ C + G
Sbjct: 692 SSPKSIVLWTGMMSGHSQNGFYEEALKFYKEMRHDGVLPDQATFVTVLRVCSVLSSLREG 751

Query: 84 RELNNVIYKCGYEGEAFVGNMLVDMY 7
R ++++I+ ++ + N L+DMY
Sbjct: 752 RAIHSLIFHLAHDLDELTSNTLIDMY 777



Score = 65.5 bits (158), Expect = 1e-10
Identities = 36/132 (27%), Positives = 66/132 (50%)
Frame = -2

Query: 402 ALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQVRDVVTWTTLIR 223
AL G+ +H++ +G + + +A+VD YAKC + + FD ++ +DV W +++
Sbjct: 75 ALRIGKAVHSKSLILGIDSEGRLGNAIVDLYAKCAQVSYAEKQFDFLE-KDVTAWNSMLS 133

Query: 222 GYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIGRELNNVIYKCGYEG 43
Y+ G + L F + + + P+ + L C E GR+++ + K G E
Sbjct: 134 MYSSIGKPGKVLRSFVSLFENQIFPNKFTFSIVLSTCARETNVEFGRQIHCSMIKMGLER 193

Query: 42 EAFVGNMLVDMY 7
++ G LVDMY
Sbjct: 194 NSYCGGALVDMY 205



Score = 61.2 bits (147), Expect = 2e-09
Identities = 35/121 (28%), Positives = 57/121 (47%)
Frame = -2

Query: 369 LKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQVRDVVTWTTLIRGYTEQGLGEEA 190
+++ G DH+ V++ Y + G L + R +F EM DVV W +I G+ ++G A
Sbjct: 252 MRDEGHRPDHLAFVTVINTYIRLGKLKDARLLFGEMSSPDVVAWNVMISGHGKRGCETVA 311

Query: 189 LACFEQMQIDGVLPDAISLVCSLKACGYAGASEIGRELNNVIYKCGYEGEAFVGNMLVDM 10
+ F M+ V +L L A G ++G ++ K G +VG+ LV M
Sbjct: 312 IEYFFNMRKSSVKSTRSTLGSVLSAIGIVANLDLGLVVHAEAIKLGLASNIYVGSSLVSM 371

Query: 9 Y 7
Y
Sbjct: 372 Y 372


>sp|Q9SR82|PP219_ARATH Putative pentatricopeptide repeat-containing
protein At3g08820 OS=Arabidopsis thaliana GN=PCMP-H84
PE=3 SV=1
Length = 685

Score = 103 bits (256), Expect = 4e-22
Identities = 53/148 (35%), Positives = 84/148 (56%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D++ V L AC +G LDSG + ++EM K+ V + +V+ YAKCG + + R VF
Sbjct: 211 DSYFIVQVLSACVHVGDLDSGEWIVKYMEEMEMQKNSFVRTTLVNLYAKCGKMEKARSVF 270

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
D M +D+VTW+T+I+GY +E + F QM + + PD S+V L +C GA +
Sbjct: 271 DSMVEKDIVTWSTMIQGYASNSFPKEGIELFLQMLQENLKPDQFSIVGFLSSCASLGALD 330

Query: 90 IGRELNNVIYKCGYEGEAFVGNMLVDMY 7
+G ++I + + F+ N L+DMY
Sbjct: 331 LGEWGISLIDRHEFLTNLFMANALIDMY 358



Score = 81.3 bits (199), Expect = 2e-15
Identities = 47/146 (32%), Positives = 75/146 (51%)
Frame = -2

Query: 444 FAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDE 265
F F LKAC+ + G LH+ + + G D ++++ Y+ G L + ++FDE
Sbjct: 112 FTFPLVLKACTRASSRKLGIDLHSLVVKCGFNHDVAAMTSLLSIYSGSGRLNDAHKLFDE 171

Query: 264 MQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIG 85
+ R VVTWT L GYT G EA+ F++M GV PD+ +V L AC + G + G
Sbjct: 172 IPDRSVVTWTALFSGYTTSGRHREAIDLFKKMVEMGVKPDSYFIVQVLSACVHVGDLDSG 231

Query: 84 RELNNVIYKCGYEGEAFVGNMLVDMY 7
+ + + + +FV LV++Y
Sbjct: 232 EWIVKYMEEMEMQKNSFVRTTLVNLY 257



Score = 72.4 bits (176), Expect = 8e-13
Identities = 44/134 (32%), Positives = 70/134 (52%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D F+ V L +C+S+GALD G + + + + +A+A++D YAKCG++ EVF
Sbjct: 312 DQFSIVGFLSSCASLGALDLGEWGISLIDRHEFLTNLFMANALIDMYAKCGAMARGFEVF 371

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
EM+ +D+V I G + G + + A F Q + G+ PD + + L C +AG +
Sbjct: 372 KEMKEKDIVIMNAAISGLAKNGHVKLSFAVFGQTEKLGISPDGSTFLGLLCGCVHAGLIQ 431

Query: 90 IGRELNNVIYKCGY 49
G N I C Y
Sbjct: 432 DGLRFFNAI-SCVY 444



Score = 44.3 bits (103), Expect = 2e-04
Identities = 22/90 (24%), Positives = 44/90 (48%)
Frame = -2

Query: 276 VFDEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGA 97
+F Q ++ + +LI G+ L E L F ++ G+ + LKAC A +
Sbjct: 67 LFSHTQFPNIFLYNSLINGFVNNHLFHETLDLFLSIRKHGLYLHGFTFPLVLKACTRASS 126

Query: 96 SEIGRELNNVIYKCGYEGEAFVGNMLVDMY 7
++G +L++++ KCG+ + L+ +Y
Sbjct: 127 RKLGIDLHSLVVKCGFNHDVAAMTSLLSIY 156


>sp|P93005|PP181_ARATH Pentatricopeptide repeat-containing protein
At2g33680 OS=Arabidopsis thaliana GN=PCMP-E19 PE=2 SV=1
Length = 727

Score = 103 bits (256), Expect = 4e-22
Identities = 54/146 (36%), Positives = 84/146 (57%)
Frame = -2

Query: 444 FAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDE 265
+ V L ACS I L+ G+QLH+ L ++G + +A+VD YAK G L + R+ FD
Sbjct: 323 YTIVGVLNACSDICYLEEGKQLHSFLLKLGFERHLFATTALVDMYAKAGCLADARKGFDC 382

Query: 264 MQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIG 85
+Q RDV WT+LI GY + EEAL + +M+ G++P+ ++ LKAC E+G
Sbjct: 383 LQERDVALWTSLISGYVQNSDNEEALILYRRMKTAGIIPNDPTMASVLKACSSLATLELG 442

Query: 84 RELNNVIYKCGYEGEAFVGNMLVDMY 7
++++ K G+ E +G+ L MY
Sbjct: 443 KQVHGHTIKHGFGLEVPIGSALSTMY 468



Score = 86.3 bits (212), Expect = 6e-17
Identities = 44/114 (38%), Positives = 66/114 (57%)
Frame = -2

Query: 426 LKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQVRDV 247
LKACSS+ L+ G+Q+H + G + + SA+ Y+KCGSL + VF +DV
Sbjct: 430 LKACSSLATLELGKQVHGHTIKHGFGLEVPIGSALSTMYSKCGSLEDGNLVFRRTPNKDV 489

Query: 246 VTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIG 85
V+W +I G + G G+EAL FE+M +G+ PD ++ V + AC + G E G
Sbjct: 490 VSWNAMISGLSHNGQGDEALELFEEMLAEGMEPDDVTFVNIISACSHKGFVERG 543



Score = 83.6 bits (205), Expect = 4e-16
Identities = 45/147 (30%), Positives = 79/147 (53%)
Frame = -2

Query: 447 NFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFD 268
++ F L + ++ + GRQ+H + G + +++A+V Y+KC SL E ++FD
Sbjct: 221 DYVFTAVLSSLAATIYVGLGRQIHCITIKNGLLGFVALSNALVTMYSKCESLNEACKMFD 280

Query: 267 EMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEI 88
R+ +TW+ ++ GY++ G EA+ F +M G+ P ++V L AC E
Sbjct: 281 SSGDRNSITWSAMVTGYSQNGESLEAVKLFSRMFSAGIKPSEYTIVGVLNACSDICYLEE 340

Query: 87 GRELNNVIYKCGYEGEAFVGNMLVDMY 7
G++L++ + K G+E F LVDMY
Sbjct: 341 GKQLHSFLLKLGFERHLFATTALVDMY 367



Score = 78.2 bits (191), Expect = 2e-14
Identities = 42/134 (31%), Positives = 72/134 (53%), Gaps = 3/134 (2%)
Frame = -2

Query: 399 LDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQVRDVVTWTTLIRG 220
L +GR +H ++ G A+ +V+FYAKCG L + +F+ + +DVV+W +LI G
Sbjct: 30 LVAGRAVHGQIIRTGASTCIQHANVLVNFYAKCGKLAKAHSIFNAIICKDVVSWNSLITG 89

Query: 219 YTEQG---LGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIGRELNNVIYKCGY 49
Y++ G + F +M+ +LP+A +L KA +S +GR+ + ++ K
Sbjct: 90 YSQNGGISSSYTVMQLFREMRAQDILPNAYTLAGIFKAESSLQSSTVGRQAHALVVKMSS 149

Query: 48 EGEAFVGNMLVDMY 7
G+ +V LV MY
Sbjct: 150 FGDIYVDTSLVGMY 163



Score = 67.0 bits (162), Expect = 4e-11
Identities = 47/144 (32%), Positives = 76/144 (52%), Gaps = 5/144 (3%)
Frame = -2

Query: 423 KACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQVRDVV 244
KA SS+ + GRQ HA + +M D V +++V Y K G + + +VF M R+
Sbjct: 126 KAESSLQSSTVGRQAHALVVKMSSFGDIYVDTSLVGMYCKAGLVEDGLKVFAYMPERNTY 185

Query: 243 TWTTLIRGYTEQGLGEEALACFE---QMQIDGVLPDAI--SLVCSLKACGYAGASEIGRE 79
TW+T++ GY +G EEA+ F + + +G D + +++ SL A Y G +GR+
Sbjct: 186 TWSTMVSGYATRGRVEEAIKVFNLFLREKEEGSDSDYVFTAVLSSLAATIYVG---LGRQ 242

Query: 78 LNNVIYKCGYEGEAFVGNMLVDMY 7
++ + K G G + N LV MY
Sbjct: 243 IHCITIKNGLLGFVALSNALVTMY 266


>sp|Q9CAY1|PP223_ARATH Putative pentatricopeptide repeat-containing
protein At3g11460 OS=Arabidopsis thaliana GN=PCMP-H52
PE=3 SV=1
Length = 623

Score = 102 bits (253), Expect = 1e-21
Identities = 47/128 (36%), Positives = 73/128 (57%)
Frame = -2

Query: 390 GRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQVRDVVTWTTLIRGYTE 211
GR LH + + G + V ++ + Y KCGS+ R +FDEM V+ ++TW +I GY++
Sbjct: 175 GRSLHGQCVKGGLDSEVAVLNSFITMYMKCGSVEAGRRLFDEMPVKGLITWNAVISGYSQ 234

Query: 210 QGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIGRELNNVIYKCGYEGEAFV 31
GL + L +EQM+ GV PD +LV L +C + GA +IG E+ ++ G+ FV
Sbjct: 235 NGLAYDVLELYEQMKSSGVCPDPFTLVSVLSSCAHLGAKKIGHEVGKLVESNGFVPNVFV 294

Query: 30 GNMLVDMY 7
N + MY
Sbjct: 295 SNASISMY 302



Score = 86.7 bits (213), Expect = 4e-17
Identities = 44/125 (35%), Positives = 70/125 (56%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D F V L +C+ +GA G ++ ++ G + + V++A + YA+CG+L + R VF
Sbjct: 256 DPFTLVSVLSSCAHLGAKKIGHEVGKLVESNGFVPNVFVSNASISMYARCGNLAKARAVF 315

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
D M V+ +V+WT +I Y G+GE L F+ M G+ PD V L AC ++G ++
Sbjct: 316 DIMPVKSLVSWTAMIGCYGMHGMGEIGLMLFDDMIKRGIRPDGAVFVMVLSACSHSGLTD 375

Query: 90 IGREL 76
G EL
Sbjct: 376 KGLEL 380



Score = 75.9 bits (185), Expect = 8e-14
Identities = 46/151 (30%), Positives = 77/151 (50%), Gaps = 2/151 (1%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D F+F LK+C+S+ SG+QLH + + G + V +A++ Y KCG + + R+VF
Sbjct: 52 DAFSFPFILKSCASLSLPVSGQQLHCHVTKGGCETEPFVLTALISMYCKCGLVADARKVF 111

Query: 270 DE--MQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGA 97
+E + V + LI GYT +A F +M+ GV D+++++ + C
Sbjct: 112 EENPQSSQLSVCYNALISGYTANSKVTDAAYMFRRMKETGVSVDSVTMLGLVPLCTVPEY 171

Query: 96 SEIGRELNNVIYKCGYEGEAFVGNMLVDMYV 4
+GR L+ K G + E V N + MY+
Sbjct: 172 LWLGRSLHGQCVKGGLDSEVAVLNSFITMYM 202



Score = 43.5 bits (101), Expect = 4e-04
Identities = 25/78 (32%), Positives = 36/78 (46%)
Frame = -2

Query: 240 WTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIGRELNNVIY 61
W +R Q L E+++ + M G PDA S LK+C G++L+ +
Sbjct: 21 WNVRLRELAYQSLFSESISLYRSMLRSGSSPDAFSFPFILKSCASLSLPVSGQQLHCHVT 80

Query: 60 KCGYEGEAFVGNMLVDMY 7
K G E E FV L+ MY
Sbjct: 81 KGGCETEPFVLTALISMY 98



Score = 35.4 bits (80), Expect = 0.11
Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 4/79 (5%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIK---DHVVASAVVDFYAKCGSLVEVR 280
D FV L ACS G D G +L +K +++ +H S +VD + G L E
Sbjct: 357 DGAVFVMVLSACSHSGLTDKGLELFRAMKREYKLEPGPEHY--SCLVDLLGRAGRLDEAM 414

Query: 279 EVFDEMQVR-DVVTWTTLI 226
E + M V D W L+
Sbjct: 415 EFIESMPVEPDGAVWGALL 433


>sp|Q9LTF4|PP429_ARATH Putative pentatricopeptide repeat-containing
protein At5g52630 OS=Arabidopsis thaliana GN=PCMP-H52
PE=3 SV=1
Length = 588

Score = 101 bits (251), Expect = 2e-21
Identities = 49/148 (33%), Positives = 82/148 (55%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D+ K+C+ + D GR +H + G D V S++VD YAKCG +V R++F
Sbjct: 115 DDHVLPSATKSCAILSRCDIGRSVHCLSMKTGYDADVFVGSSLVDMYAKCGEIVYARKMF 174

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
DEM R+VVTW+ ++ GY + G EEAL F++ + + + S + C + E
Sbjct: 175 DEMPQRNVVTWSGMMYGYAQMGENEEALWLFKEALFENLAVNDYSFSSVISVCANSTLLE 234

Query: 90 IGRELNNVIYKCGYEGEAFVGNMLVDMY 7
+GR+++ + K ++ +FVG+ LV +Y
Sbjct: 235 LGRQIHGLSIKSSFDSSSFVGSSLVSLY 262



Score = 70.1 bits (170), Expect = 4e-12
Identities = 41/148 (27%), Positives = 75/148 (50%), Gaps = 1/148 (0%)
Frame = -2

Query: 447 NFAFVCGLKACSS-IGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
N+ +C L S+ + G QLH + + G +VA+ +++FY+K + R F
Sbjct: 14 NYNQICDLLLSSARTRSTIKGLQLHGYVVKSGLSLIPLVANNLINFYSKSQLPFDSRRAF 73

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
++ + TW+++I + + L +L ++M + PD L + K+C +
Sbjct: 74 EDSPQKSSTTWSSIISCFAQNELPWMSLEFLKKMMAGNLRPDDHVLPSATKSCAILSRCD 133

Query: 90 IGRELNNVIYKCGYEGEAFVGNMLVDMY 7
IGR ++ + K GY+ + FVG+ LVDMY
Sbjct: 134 IGRSVHCLSMKTGYDADVFVGSSLVDMY 161



Score = 69.7 bits (169), Expect = 5e-12
Identities = 32/123 (26%), Positives = 68/123 (55%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
++++F + C++ L+ GRQ+H + V S++V Y+KCG +VF
Sbjct: 216 NDYSFSSVISVCANSTLLELGRQIHGLSIKSSFDSSSFVGSSLVSLYSKCGVPEGAYQVF 275

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
+E+ V+++ W +++ Y + ++ + F++M++ G+ P+ I+ + L AC +AG +
Sbjct: 276 NEVPVKNLGIWNAMLKAYAQHSHTQKVIELFKRMKLSGMKPNFITFLNVLNACSHAGLVD 335

Query: 90 IGR 82
GR
Sbjct: 336 EGR 338



Score = 32.7 bits (73), Expect = 0.74
Identities = 22/76 (28%), Positives = 33/76 (43%), Gaps = 1/76 (1%)
Frame = -2

Query: 438 FVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQ 259
F+ L ACS G +D GR ++KE +++VD + G L E EV M
Sbjct: 321 FLNVLNACSHAGLVDEGRYYFDQMKESRIEPTDKHYASLVDMLGRAGRLQEALEVITNMP 380

Query: 258 VRDVVT-WTTLIRGYT 214
+ + W L+ T
Sbjct: 381 IDPTESVWGALLTSCT 396


>sp|Q9SMZ2|PP347_ARATH Pentatricopeptide repeat-containing protein
At4g33170 OS=Arabidopsis thaliana GN=PCMP-H53 PE=2 SV=1
Length = 990

Score = 101 bits (251), Expect = 2e-21
Identities = 55/148 (37%), Positives = 77/148 (52%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D+F K C + A++ G+Q+HA + G D V+S ++D Y KCG + + F
Sbjct: 516 DDFTLATVFKTCGFLFAINQGKQVHAYAIKSGYDLDLWVSSGILDMYVKCGDMSAAQFAF 575

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
D + V D V WTT+I G E G E A F QM++ GVLPD ++ KA A E
Sbjct: 576 DSIPVPDDVAWTTMISGCIENGEEERAFHVFSQMRLMGVLPDEFTIATLAKASSCLTALE 635

Query: 90 IGRELNNVIYKCGYEGEAFVGNMLVDMY 7
GR+++ K + FVG LVDMY
Sbjct: 636 QGRQIHANALKLNCTNDPFVGTSLVDMY 663



Score = 85.9 bits (211), Expect = 7e-17
Identities = 39/117 (33%), Positives = 67/117 (57%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D F KA S + AL+ GRQ+HA ++ D V +++VD YAKCGS+ + +F
Sbjct: 617 DEFTIATLAKASSCLTALEQGRQIHANALKLNCTNDPFVGTSLVDMYAKCGSIDDAYCLF 676

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAG 100
+++ ++ W ++ G + G G+E L F+QM+ G+ PD ++ + L AC ++G
Sbjct: 677 KRIEMMNITAWNAMLVGLAQHGEGKETLQLFKQMKSLGIKPDKVTFIGVLSACSHSG 733



Score = 75.1 bits (183), Expect = 1e-13
Identities = 42/150 (28%), Positives = 75/150 (50%), Gaps = 1/150 (0%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIG-ALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREV 274
D + LKA SS+ L +Q+H ++ + D V++A++D Y++ + E +
Sbjct: 415 DQYTMTSVLKAASSLPEGLSLSKQVHVHAIKINNVSDSFVSTALIDAYSRNRCMKEAEIL 474

Query: 273 FDEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGAS 94
F+ D+V W ++ GYT+ G + L F M G D +L K CG+ A
Sbjct: 475 FERHNF-DLVAWNAMMAGYTQSHDGHKTLKLFALMHKQGERSDDFTLATVFKTCGFLFAI 533

Query: 93 EIGRELNNVIYKCGYEGEAFVGNMLVDMYV 4
G++++ K GY+ + +V + ++DMYV
Sbjct: 534 NQGKQVHAYAIKSGYDLDLWVSSGILDMYV 563



Score = 67.4 bits (163), Expect = 3e-11
Identities = 39/149 (26%), Positives = 71/149 (47%), Gaps = 1/149 (0%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D F+ L + +L G+Q+H ++G V++++++ Y K R VF
Sbjct: 314 DQVTFILMLATAVKVDSLALGQQVHCMALKLGLDLMLTVSNSLINMYCKLRKFGFARTVF 373

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKAC-GYAGAS 94
D M RD+++W ++I G + GL EA+ F Q+ G+ PD ++ LKA
Sbjct: 374 DNMSERDLISWNSVIAGIAQNGLEVEAVCLFMQLLRCGLKPDQYTMTSVLKAASSLPEGL 433

Query: 93 EIGRELNNVIYKCGYEGEAFVGNMLVDMY 7
+ ++++ K ++FV L+D Y
Sbjct: 434 SLSKQVHVHAIKINNVSDSFVSTALIDAY 462



Score = 65.5 bits (158), Expect = 1e-10
Identities = 36/134 (26%), Positives = 65/134 (48%), Gaps = 5/134 (3%)
Frame = -2

Query: 390 GRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQVRDVVTWTTLIRGYTE 211
G+ HA + + + + ++ Y+KCGSL R VFD+M RD+V+W +++ Y +
Sbjct: 58 GKCTHARILTFEENPERFLINNLISMYSKCGSLTYARRVFDKMPDRDLVSWNSILAAYAQ 117

Query: 210 QGLG-----EEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIGRELNNVIYKCGYE 46
++A F ++ D V ++L LK C ++G + K G +
Sbjct: 118 SSECVVENIQQAFLLFRILRQDVVYTSRMTLSPMLKLCLHSGYVWASESFHGYACKIGLD 177

Query: 45 GEAFVGNMLVDMYV 4
G+ FV LV++Y+
Sbjct: 178 GDEFVAGALVNIYL 191



Score = 62.4 bits (150), Expect = 9e-10
Identities = 33/98 (33%), Positives = 50/98 (51%)
Frame = -2

Query: 426 LKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQVRDV 247
LK C G + + H ++G D VA A+V+ Y K G + E + +F+EM RDV
Sbjct: 152 LKLCLHSGYVWASESFHGYACKIGLDGDEFVAGALVNIYLKFGKVKEGKVLFEEMPYRDV 211

Query: 246 VTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISL 133
V W +++ Y E G EEA+ G+ P+ I+L
Sbjct: 212 VLWNLMLKAYLEMGFKEEAIDLSSAFHSSGLNPNEITL 249


tr_hit_id A7PM23
Definition tr|A7PM23|A7PM23_VITVI Chromosome chr14 scaffold_21, whole genome shotgun sequence OS=Vitis vinifera
Align length 148
Score (bit) 118.0
E-value 1.0e-25
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916683|Adiantum capillus-veneris mRNA, clone:
YMU001_000090_D03.
(451 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PM23|A7PM23_VITVI Chromosome chr14 scaffold_21, whole genom... 118 1e-25
tr|B8LQA8|B8LQA8_PICSI Putative uncharacterized protein OS=Picea... 117 4e-25
tr|Q2QWV0|Q2QWV0_ORYSJ Os12g0181900 protein OS=Oryza sativa subs... 116 5e-25
tr|A2ZIP8|A2ZIP8_ORYSI Putative uncharacterized protein OS=Oryza... 116 6e-25
tr|A7PPE3|A7PPE3_VITVI Chromosome chr8 scaffold_23, whole genome... 115 8e-25
tr|A5AR18|A5AR18_VITVI Putative uncharacterized protein OS=Vitis... 115 8e-25
tr|A7PEB0|A7PEB0_VITVI Chromosome chr11 scaffold_13, whole genom... 115 1e-24
tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella paten... 114 2e-24
tr|A7QIL2|A7QIL2_VITVI Chromosome chr9 scaffold_104, whole genom... 114 2e-24
tr|A9T938|A9T938_PHYPA Predicted protein OS=Physcomitrella paten... 114 2e-24
tr|A7NVQ9|A7NVQ9_VITVI Chromosome chr18 scaffold_1, whole genome... 114 2e-24
tr|A5AJZ0|A5AJZ0_VITVI Putative uncharacterized protein OS=Vitis... 114 2e-24
tr|A7PPB6|A7PPB6_VITVI Chromosome chr8 scaffold_23, whole genome... 113 4e-24
tr|A5C1S9|A5C1S9_VITVI Putative uncharacterized protein OS=Vitis... 113 4e-24
tr|Q0DF57|Q0DF57_ORYSJ Os06g0114300 protein OS=Oryza sativa subs... 113 5e-24
tr|B8B1L4|B8B1L4_ORYSI Putative uncharacterized protein OS=Oryza... 113 5e-24
tr|A3B7Q9|A3B7Q9_ORYSJ Putative uncharacterized protein OS=Oryza... 113 5e-24
tr|Q10S36|Q10S36_ORYSJ Pentatricopeptide, putative, expressed (P... 112 1e-23
tr|A7R0D7|A7R0D7_VITVI Chromosome chr6 scaffold_305, whole genom... 111 2e-23
tr|A7Q087|A7Q087_VITVI Chromosome chr7 scaffold_42, whole genome... 110 3e-23
tr|A7PWD6|A7PWD6_VITVI Chromosome chr8 scaffold_34, whole genome... 110 5e-23
tr|A2XC93|A2XC93_ORYSI Putative uncharacterized protein OS=Oryza... 109 6e-23
tr|Q2QTL4|Q2QTL4_ORYSJ Os12g0289800 protein OS=Oryza sativa subs... 108 1e-22
tr|Q2HS18|Q2HS18_MEDTR Tetratricopeptide-like helical OS=Medicag... 108 1e-22
tr|B4FW77|B4FW77_MAIZE Putative uncharacterized protein OS=Zea m... 108 1e-22
tr|A3CGJ4|A3CGJ4_ORYSJ Putative uncharacterized protein OS=Oryza... 108 1e-22
tr|Q1KSA8|Q1KSA8_SORBI Putative uncharacterized protein OS=Sorgh... 108 1e-22
tr|A9RLJ0|A9RLJ0_PHYPA Predicted protein OS=Physcomitrella paten... 108 2e-22
tr|A3B2H6|A3B2H6_ORYSJ Putative uncharacterized protein OS=Oryza... 108 2e-22
tr|A2Y335|A2Y335_ORYSI Putative uncharacterized protein OS=Oryza... 108 2e-22

>tr|A7PM23|A7PM23_VITVI Chromosome chr14 scaffold_21, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00020655001
PE=4 SV=1
Length = 614

Score = 118 bits (296), Expect = 1e-25
Identities = 58/148 (39%), Positives = 86/148 (58%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D FAF LK+C+ + L G+ +H L G D V +A+VD YAKCG + R VF
Sbjct: 140 DKFAFPFALKSCAGLSDLQRGKVIHQHLVCCGCSNDLFVDAALVDMYAKCGDIEAARLVF 199

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
D+M VRD+V+WT++I GY G E L F+ M+ GV+P+ +S++ L ACG GA
Sbjct: 200 DKMAVRDLVSWTSMISGYAHNGYNSETLGFFDLMRSSGVIPNRVSILSVLLACGNLGALR 259

Query: 90 IGRELNNVIYKCGYEGEAFVGNMLVDMY 7
G ++ + + G+E + V ++DMY
Sbjct: 260 KGEWFHSYVIQTGFEFDILVATAIMDMY 287



Score = 89.4 bits (220), Expect = 8e-17
Identities = 45/115 (39%), Positives = 68/115 (59%)
Frame = -2

Query: 426 LKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQVRDV 247
L AC ++GAL G H+ + + G D +VA+A++D Y+KCGSL R +FDE +D+
Sbjct: 249 LLACGNLGALRKGEWFHSYVIQTGFEFDILVATAIMDMYSKCGSLDLARCLFDETAGKDL 308

Query: 246 VTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIGR 82
V W+ +I Y G G +A+ F+QM GV P ++ C L AC ++G E G+
Sbjct: 309 VCWSAMIASYGIHGHGRKAIDLFDQMVKAGVRPSHVTFTCVLSACSHSGLLEEGK 363



Score = 57.0 bits (136), Expect = 5e-07
Identities = 35/142 (24%), Positives = 62/142 (43%)
Frame = -2

Query: 432 CGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQVR 253
C L+ C+S L ++ HA++ G D + + Y + VF+++
Sbjct: 48 CVLQECTSFSCL---KKTHAKIFAYGLQYDSRILTKFAIMYVSFNRIDAASIVFEDIPNP 104

Query: 252 DVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIGRELN 73
W +IRG+ G +L + +M G+ PD + +LK+C + G+ ++
Sbjct: 105 CSFLWNVMIRGFATDGRFLSSLELYSKMMEKGLKPDKFAFPFALKSCAGLSDLQRGKVIH 164

Query: 72 NVIYKCGYEGEAFVGNMLVDMY 7
+ CG + FV LVDMY
Sbjct: 165 QHLVCCGCSNDLFVDAALVDMY 186


>tr|B8LQA8|B8LQA8_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 795

Score = 117 bits (292), Expect = 4e-25
Identities = 57/148 (38%), Positives = 88/148 (59%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D F+ +KAC S L +GR++H ++ G D +V +A+ Y KCGSL R+VF
Sbjct: 119 DKLVFLSVIKACGSQSDLQAGRKVHEDIIARGFESDVIVGTALASMYTKCGSLENARQVF 178

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
D M RDVV+W +I GY++ G EALA F +MQ++G+ P++ +LV + C + A E
Sbjct: 179 DRMPKRDVVSWNAIIAGYSQNGQPYEALALFSEMQVNGIKPNSSTLVSVMPVCAHLLALE 238

Query: 90 IGRELNNVIYKCGYEGEAFVGNMLVDMY 7
G++++ + G E + V N LV+MY
Sbjct: 239 QGKQIHCYAIRSGIESDVLVVNGLVNMY 266



Score = 108 bits (269), Expect = 2e-22
Identities = 53/148 (35%), Positives = 87/148 (58%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
++ V L AC+ + AL+ G+Q+H G + VV +A+V+ YAKCG++ ++F
Sbjct: 321 NSITMVSVLPACAHLFALEQGQQIHGYAIRSGFESNDVVGNALVNMYAKCGNVNSAYKLF 380

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
+ M ++VV W +I GY++ G EALA F +MQ G+ PD+ ++V L AC + A E
Sbjct: 381 ERMPKKNVVAWNAIISGYSQHGHPHEALALFIEMQAQGIKPDSFAIVSVLPACAHFLALE 440

Query: 90 IGRELNNVIYKCGYEGEAFVGNMLVDMY 7
G++++ + G+E VG LVD+Y
Sbjct: 441 QGKQIHGYTIRSGFESNVVVGTGLVDIY 468



Score = 106 bits (265), Expect = 5e-22
Identities = 50/140 (35%), Positives = 84/140 (60%)
Frame = -2

Query: 426 LKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQVRDV 247
+ C+ + AL+ G+Q+H G D +V + +V+ YAKCG++ ++F+ M +RDV
Sbjct: 228 MPVCAHLLALEQGKQIHCYAIRSGIESDVLVVNGLVNMYAKCGNVNTAHKLFERMPIRDV 287

Query: 246 VTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIGRELNNV 67
+W +I GY+ EALA F +MQ+ G+ P++I++V L AC + A E G++++
Sbjct: 288 ASWNAIIGGYSLNSQHHEALAFFNRMQVRGIKPNSITMVSVLPACAHLFALEQGQQIHGY 347

Query: 66 IYKCGYEGEAFVGNMLVDMY 7
+ G+E VGN LV+MY
Sbjct: 348 AIRSGFESNDVVGNALVNMY 367



Score = 95.5 bits (236), Expect = 1e-18
Identities = 50/122 (40%), Positives = 72/122 (59%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D+FA V L AC+ AL+ G+Q+H G + VV + +VD YAKCG++ +++F
Sbjct: 422 DSFAIVSVLPACAHFLALEQGKQIHGYTIRSGFESNVVVGTGLVDIYAKCGNVNTAQKLF 481

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
+ M +DVV+WTT+I Y G GE+ALA F +MQ G D I+ L AC +AG +
Sbjct: 482 ERMPEQDVVSWTTMILAYGIHGHGEDALALFSKMQETGTKLDHIAFTAILTACSHAGLVD 541

Query: 90 IG 85
G
Sbjct: 542 QG 543



Score = 58.5 bits (140), Expect = 2e-07
Identities = 30/90 (33%), Positives = 46/90 (51%), Gaps = 1/90 (1%)
Frame = -2

Query: 273 FDEMQVRD-VVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGA 97
F + +R+ V W I GY + G +AL + QMQ G+ PD + + +KACG
Sbjct: 76 FTQTDIRNNAVVWKETIIGYVKNGFWNKALRLYYQMQRTGINPDKLVFLSVIKACGSQSD 135

Query: 96 SEIGRELNNVIYKCGYEGEAFVGNMLVDMY 7
+ GR+++ I G+E + VG L MY
Sbjct: 136 LQAGRKVHEDIIARGFESDVIVGTALASMY 165


>tr|Q2QWV0|Q2QWV0_ORYSJ Os12g0181900 protein OS=Oryza sativa subsp.
japonica GN=Os12g0181900 PE=4 SV=1
Length = 584

Score = 116 bits (291), Expect = 5e-25
Identities = 57/147 (38%), Positives = 87/147 (59%)
Frame = -2

Query: 447 NFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFD 268
+FAF KAC+ + AL +G +HA +G D V +A+V Y+KCG L R++FD
Sbjct: 109 SFAFTAAAKACADLSALRTGMAVHAHSVLLGFGSDRFVQTALVVLYSKCGQLPVARKLFD 168

Query: 267 EMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEI 88
++ R VV W +I GY + GL E A+ + +MQ+ V+PD+ + V +L AC AGA ++
Sbjct: 169 AIRDRSVVAWNAMISGYEQNGLAERAIEVYREMQVAQVVPDSATFVATLSACAQAGALDL 228

Query: 87 GRELNNVIYKCGYEGEAFVGNMLVDMY 7
GRE+ I + F+G+ LV+MY
Sbjct: 229 GREVERRIVSDQMDVSVFLGSALVNMY 255



Score = 94.4 bits (233), Expect = 3e-18
Identities = 48/123 (39%), Positives = 71/123 (57%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D+ FV L AC+ GALD GR++ + + SA+V+ YA+CG + + R+ F
Sbjct: 209 DSATFVATLSACAQAGALDLGREVERRIVSDQMDVSVFLGSALVNMYARCGLVSKARDWF 268

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
D +Q R+VVTWT++I GY G G EA+ F M+ +G P+ ++ V L AC +AG
Sbjct: 269 DRLQERNVVTWTSMIAGYGMHGHGREAIKLFHLMRREGPTPNDVTFVAVLAACAHAGLVN 328

Query: 90 IGR 82
GR
Sbjct: 329 EGR 331


>tr|A2ZIP8|A2ZIP8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_37700 PE=4 SV=1
Length = 584

Score = 116 bits (290), Expect = 6e-25
Identities = 57/147 (38%), Positives = 87/147 (59%)
Frame = -2

Query: 447 NFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFD 268
+FAF KAC+ + AL +G +HA +G D V +A+V Y+KCG L R++FD
Sbjct: 109 SFAFTAAAKACADLSALRTGMAVHAHSVLLGFGSDRFVQTALVVLYSKCGQLPVARKLFD 168

Query: 267 EMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEI 88
++ R VV W +I GY + GL E A+ + +MQ+ V+PD+ + V +L AC AGA ++
Sbjct: 169 AIRDRSVVAWNAMISGYEQNGLAERAIEVYREMQVAQVVPDSATFVTTLSACAQAGALDL 228

Query: 87 GRELNNVIYKCGYEGEAFVGNMLVDMY 7
GRE+ I + F+G+ LV+MY
Sbjct: 229 GREVERRIVSDQMDVSVFLGSALVNMY 255



Score = 94.4 bits (233), Expect = 3e-18
Identities = 48/123 (39%), Positives = 72/123 (58%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D+ FV L AC+ GALD GR++ + + SA+V+ YA+CG + + R+ F
Sbjct: 209 DSATFVTTLSACAQAGALDLGREVERRIVSDQMDVSVFLGSALVNMYARCGLVSKARDWF 268

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
D +Q R+VVTWT++I GY G G EA+ F M+++G P+ ++ V L AC +AG
Sbjct: 269 DRLQERNVVTWTSMIAGYGMHGHGCEAIKLFHLMRLEGPTPNDVTFVAVLAACAHAGLVN 328

Query: 90 IGR 82
GR
Sbjct: 329 EGR 331


>tr|A7PPE3|A7PPE3_VITVI Chromosome chr8 scaffold_23, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00021620001
PE=4 SV=1
Length = 681

Score = 115 bits (289), Expect = 8e-25
Identities = 57/146 (39%), Positives = 91/146 (62%)
Frame = -2

Query: 444 FAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDE 265
FAF ++AC+S+G+++ G+Q+H + G + V S + D Y+KCG++ + +VF+E
Sbjct: 107 FAFSSAIRACASLGSIEMGKQMHCLALKFGIGSELFVGSNLEDMYSKCGAMFDACKVFEE 166

Query: 264 MQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIG 85
M +D V+WT +I GY++ G EEAL F++M + V D L +L ACG A + G
Sbjct: 167 MPCKDEVSWTAMIDGYSKIGEFEEALLAFKKMIDEEVTIDQHVLCSTLGACGALKACKFG 226

Query: 84 RELNNVIYKCGYEGEAFVGNMLVDMY 7
R +++ + K G+E + FVGN L DMY
Sbjct: 227 RSVHSSVVKLGFESDIFVGNALTDMY 252



Score = 91.7 bits (226), Expect = 2e-17
Identities = 45/122 (36%), Positives = 73/122 (59%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
+ F F +KAC++ AL+ G QLHA++ ++ +D V+S +VD Y KCG L + + F
Sbjct: 308 NEFTFSSLIKACANQAALEQGTQLHAQVMKINFDEDPFVSSILVDMYGKCGLLEQAIQAF 367

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
DE+ + W +L+ + + GLG++A+ FE+M GV P+AI+ + L C +AG E
Sbjct: 368 DEIGDPTEIAWNSLVSVFGQHGLGKDAIKIFERMVDRGVKPNAITFISLLTGCSHAGLVE 427

Query: 90 IG 85
G
Sbjct: 428 EG 429



Score = 86.7 bits (213), Expect = 5e-16
Identities = 47/149 (31%), Positives = 80/149 (53%), Gaps = 1/149 (0%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D L AC ++ A GR +H+ + ++G D V +A+ D Y+K G + VF
Sbjct: 206 DQHVLCSTLGACGALKACKFGRSVHSSVVKLGFESDIFVGNALTDMYSKAGDMESASNVF 265

Query: 270 D-EMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGAS 94
+ + R+VV++T LI GY E E+ L+ F +++ G+ P+ + +KAC A
Sbjct: 266 GIDSECRNVVSYTCLIDGYVETEQIEKGLSVFVELRRQGIEPNEFTFSSLIKACANQAAL 325

Query: 93 EIGRELNNVIYKCGYEGEAFVGNMLVDMY 7
E G +L+ + K ++ + FV ++LVDMY
Sbjct: 326 EQGTQLHAQVMKINFDEDPFVSSILVDMY 354



Score = 84.3 bits (207), Expect = 3e-15
Identities = 45/131 (34%), Positives = 74/131 (56%)
Frame = -2

Query: 399 LDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQVRDVVTWTTLIRG 220
L G+QLHA L G + + +V+ Y+KCG L ++FD M R++V+WT +I G
Sbjct: 21 LRRGKQLHALLICAGYTPCTFLTNHLVNMYSKCGELDHALKLFDTMPQRNLVSWTAMISG 80

Query: 219 YTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIGRELNNVIYKCGYEGE 40
++ EA+ F M+I G +P + +++AC G+ E+G++++ + K G E
Sbjct: 81 LSQNSKFSEAIRTFCGMRICGEVPTQFAFSSAIRACASLGSIEMGKQMHCLALKFGIGSE 140

Query: 39 AFVGNMLVDMY 7
FVG+ L DMY
Sbjct: 141 LFVGSNLEDMY 151


>tr|A5AR18|A5AR18_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_018275 PE=4 SV=1
Length = 681

Score = 115 bits (289), Expect = 8e-25
Identities = 57/146 (39%), Positives = 91/146 (62%)
Frame = -2

Query: 444 FAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDE 265
FAF ++AC+S+G+++ G+Q+H + G + V S + D Y+KCG++ + +VF+E
Sbjct: 107 FAFSSAIRACASLGSIEMGKQMHCLALKFGIGSELFVGSNLEDMYSKCGAMFDACKVFEE 166

Query: 264 MQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIG 85
M +D V+WT +I GY++ G EEAL F++M + V D L +L ACG A + G
Sbjct: 167 MPCKDEVSWTAMIDGYSKIGEFEEALLAFKKMIDEEVTIDQHVLCSTLGACGALKACKFG 226

Query: 84 RELNNVIYKCGYEGEAFVGNMLVDMY 7
R +++ + K G+E + FVGN L DMY
Sbjct: 227 RSVHSSVVKLGFESDIFVGNALTDMY 252



Score = 90.5 bits (223), Expect = 4e-17
Identities = 45/122 (36%), Positives = 72/122 (59%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
+ F F +KAC++ AL+ G QLHA++ ++ +D V+S +VD Y KCG L + F
Sbjct: 308 NEFTFSSLIKACANQAALEQGTQLHAQVMKINFDEDPFVSSILVDMYGKCGLLEHAIQAF 367

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
DE+ + W +L+ + + GLG++A+ FE+M GV P+AI+ + L C +AG E
Sbjct: 368 DEIGDPTEIAWNSLVSVFGQHGLGKDAIKFFERMVDRGVKPNAITFISLLTGCSHAGLVE 427

Query: 90 IG 85
G
Sbjct: 428 EG 429



Score = 86.7 bits (213), Expect = 5e-16
Identities = 47/149 (31%), Positives = 80/149 (53%), Gaps = 1/149 (0%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D L AC ++ A GR +H+ + ++G D V +A+ D Y+K G + VF
Sbjct: 206 DQHVLCSTLGACGALKACKFGRSVHSSVVKLGFESDIFVGNALTDMYSKAGDMESASNVF 265

Query: 270 D-EMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGAS 94
+ + R+VV++T LI GY E E+ L+ F +++ G+ P+ + +KAC A
Sbjct: 266 GIDSECRNVVSYTCLIDGYVETEQIEKGLSVFVELRRQGIEPNEFTFSSLIKACANQAAL 325

Query: 93 EIGRELNNVIYKCGYEGEAFVGNMLVDMY 7
E G +L+ + K ++ + FV ++LVDMY
Sbjct: 326 EQGTQLHAQVMKINFDEDPFVSSILVDMY 354



Score = 84.3 bits (207), Expect = 3e-15
Identities = 45/131 (34%), Positives = 74/131 (56%)
Frame = -2

Query: 399 LDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQVRDVVTWTTLIRG 220
L G+QLHA L G + + +V+ Y+KCG L ++FD M R++V+WT +I G
Sbjct: 21 LRRGKQLHALLICAGYTPCTFLTNHLVNMYSKCGELDHALKLFDTMPQRNLVSWTAMISG 80

Query: 219 YTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIGRELNNVIYKCGYEGE 40
++ EA+ F M+I G +P + +++AC G+ E+G++++ + K G E
Sbjct: 81 LSQNSKFSEAIRTFCGMRICGEVPTQFAFSSAIRACASLGSIEMGKQMHCLALKFGIGSE 140

Query: 39 AFVGNMLVDMY 7
FVG+ L DMY
Sbjct: 141 LFVGSNLEDMY 151


>tr|A7PEB0|A7PEB0_VITVI Chromosome chr11 scaffold_13, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00016595001
PE=4 SV=1
Length = 1005

Score = 115 bits (288), Expect = 1e-24
Identities = 54/146 (36%), Positives = 88/146 (60%)
Frame = -2

Query: 444 FAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDE 265
+ F+ L++CSS+ +D G+Q+HA++ + + V +A+VD YAK L + +F+
Sbjct: 533 YTFISILRSCSSLSDVDLGKQVHAQIVKNSLDGNDFVGTALVDMYAKNRFLEDAETIFNR 592

Query: 264 MQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIG 85
+ RD+ WT ++ GY + G GE+A+ CF QMQ +GV P+ +L SL C + G
Sbjct: 593 LIKRDLFAWTVIVAGYAQDGQGEKAVKCFIQMQREGVKPNEFTLASSLSGCSRIATLDSG 652

Query: 84 RELNNVIYKCGYEGEAFVGNMLVDMY 7
R+L+++ K G G+ FV + LVDMY
Sbjct: 653 RQLHSMAIKAGQSGDMFVASALVDMY 678



Score = 109 bits (272), Expect = 8e-23
Identities = 55/131 (41%), Positives = 77/131 (58%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
+ F L CS I LDSGRQLH+ + G+ D VASA+VD YAKCG + + VF
Sbjct: 632 NEFTLASSLSGCSRIATLDSGRQLHSMAIKAGQSGDMFVASALVDMYAKCGCVEDAEVVF 691

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
D + RD V+W T+I GY++ G G +AL FE M +G +PD ++ + L AC + G E
Sbjct: 692 DGLVSRDTVSWNTIICGYSQHGQGGKALKAFEAMLDEGTVPDEVTFIGVLSACSHMGLIE 751

Query: 90 IGRELNNVIYK 58
G++ N + K
Sbjct: 752 EGKKHFNSLSK 762



Score = 95.1 bits (235), Expect = 2e-18
Identities = 50/140 (35%), Positives = 82/140 (58%)
Frame = -2

Query: 426 LKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQVRDV 247
L+ C+S G L+ G+ +H ++ + G D + +++V+ YAKCGS +VF E+ RDV
Sbjct: 135 LRTCASKGDLNEGKAIHGQVIKSGINPDSHLWNSLVNVYAKCGSANYACKVFGEIPERDV 194

Query: 246 VTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIGRELNNV 67
V+WT LI G+ +G G A+ F +M+ +GV + + +LKAC E G++++
Sbjct: 195 VSWTALITGFVAEGYGSGAVNLFCEMRREGVEANEFTYATALKACSMCLDLEFGKQVHAE 254

Query: 66 IYKCGYEGEAFVGNMLVDMY 7
K G + FVG+ LVD+Y
Sbjct: 255 AIKVGDFSDLFVGSALVDLY 274



Score = 92.8 bits (229), Expect = 8e-18
Identities = 51/148 (34%), Positives = 79/148 (53%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
+ F + LKACS L+ G+Q+HAE ++G D V SA+VD YAKCG +V VF
Sbjct: 228 NEFTYATALKACSMCLDLEFGKQVHAEAIKVGDFSDLFVGSALVDLYAKCGEMVLAERVF 287

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
M ++ V+W L+ G+ + G E+ L F +M + +L LK C +G
Sbjct: 288 LCMPKQNAVSWNALLNGFAQMGDAEKVLNLFCRMTGSEINFSKFTLSTVLKGCANSGNLR 347

Query: 90 IGRELNNVIYKCGYEGEAFVGNMLVDMY 7
G+ ++++ + G E + F+ LVDMY
Sbjct: 348 AGQIVHSLAIRIGCELDEFISCCLVDMY 375



Score = 81.6 bits (200), Expect = 2e-14
Identities = 43/148 (29%), Positives = 76/148 (51%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
+ F + A + +G L G +HA + + G D+ V +A+V Y K GS+ + VF
Sbjct: 430 NQFTLASLVSAATDLGDLYYGESIHACVCKYGFEYDNTVCNALVTMYMKIGSVQDGCRVF 489

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
+ RD+++W L+ G+ + + L F QM +G P+ + + L++C +
Sbjct: 490 EATTNRDLISWNALLSGFHDNETCDTGLRIFNQMLAEGFNPNMYTFISILRSCSSLSDVD 549

Query: 90 IGRELNNVIYKCGYEGEAFVGNMLVDMY 7
+G++++ I K +G FVG LVDMY
Sbjct: 550 LGKQVHAQIVKNSLDGNDFVGTALVDMY 577



Score = 79.0 bits (193), Expect = 1e-13
Identities = 43/141 (30%), Positives = 76/141 (53%)
Frame = -2

Query: 426 LKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQVRDV 247
LK C++ G L +G+ +H+ +G D ++ +VD Y+KCG + +VF ++ DV
Sbjct: 337 LKGCANSGNLRAGQIVHSLAIRIGCELDEFISCCLVDMYSKCGLAGDALKVFVRIEDPDV 396

Query: 246 VTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIGRELNNV 67
V+W+ +I ++G EA F++M+ GV+P+ +L + A G G ++
Sbjct: 397 VSWSAIITCLDQKGQSREAAEVFKRMRHSGVIPNQFTLASLVSAATDLGDLYYGESIHAC 456

Query: 66 IYKCGYEGEAFVGNMLVDMYV 4
+ K G+E + V N LV MY+
Sbjct: 457 VCKYGFEYDNTVCNALVTMYM 477


>tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_192620 PE=4 SV=1
Length = 902

Score = 114 bits (286), Expect = 2e-24
Identities = 55/140 (39%), Positives = 87/140 (62%)
Frame = -2

Query: 426 LKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQVRDV 247
L ACSS AL+ GR++H ++ E G D V + +V+ Y+ CGS+ + R+VFD M RD+
Sbjct: 436 LNACSSPAALEWGRRIHQQVVEAGLATDAHVGNTLVNMYSMCGSVKDARQVFDRMIQRDI 495

Query: 246 VTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIGRELNNV 67
V + +I GY LG+EAL F+++Q +G+ PD ++ + L AC +G+ E RE++ +
Sbjct: 496 VAYNAMIGGYAAHNLGKEALKLFDRLQEEGLKPDKVTYINMLNACANSGSLEWAREIHTL 555

Query: 66 IYKCGYEGEAFVGNMLVDMY 7
+ K G+ + VGN LV Y
Sbjct: 556 VRKGGFFSDTSVGNALVSTY 575



Score = 112 bits (281), Expect = 7e-24
Identities = 56/148 (37%), Positives = 89/148 (60%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D + L +C S GAL+ GR++H + + G + D VA+ +++ YAKCGS+ E REVF
Sbjct: 125 DRTTIMSFLSSCKSPGALEWGREIHFQAMQAGLLFDVKVANCILNMYAKCGSIEEAREVF 184

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
D+M+ + VV+WT I GY + G E A F++M+ +GV+P+ I+ + L A A +
Sbjct: 185 DKMEKKSVVSWTITIGGYADCGRSETAFEIFQKMEQEGVVPNRITYISVLNAFSSPAALK 244

Query: 90 IGRELNNVIYKCGYEGEAFVGNMLVDMY 7
G+ +++ I G+E + VG LV MY
Sbjct: 245 WGKAVHSRILNAGHESDTAVGTALVKMY 272



Score = 109 bits (273), Expect = 6e-23
Identities = 53/148 (35%), Positives = 87/148 (58%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
+ +V L AC + AL G+++H+ + + G D V +A++ Y++CGS+ + R VF
Sbjct: 327 NKITYVILLNACVNSAALHWGKEIHSRVAKAGFTSDIGVQNALISMYSRCGSIKDARLVF 386

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
D+M +DV++WT +I G + G G EAL +++MQ GV P+ ++ L AC A E
Sbjct: 387 DKMVRKDVISWTAMIGGLAKSGFGAEALTVYQEMQQAGVEPNRVTYTSILNACSSPAALE 446

Query: 90 IGRELNNVIYKCGYEGEAFVGNMLVDMY 7
GR ++ + + G +A VGN LV+MY
Sbjct: 447 WGRRIHQQVVEAGLATDAHVGNTLVNMY 474



Score = 106 bits (265), Expect = 5e-22
Identities = 54/148 (36%), Positives = 85/148 (57%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
+ ++ L A SS AL G+ +H+ + G D V +A+V YAKCGS + R+VF
Sbjct: 226 NRITYISVLNAFSSPAALKWGKAVHSRILNAGHESDTAVGTALVKMYAKCGSYKDCRQVF 285

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
+++ RD++ W T+I G E G EEA + QMQ +GV+P+ I+ V L AC + A
Sbjct: 286 EKLVNRDLIAWNTMIGGLAEGGYWEEASEVYNQMQREGVMPNKITYVILLNACVNSAALH 345

Query: 90 IGRELNNVIYKCGYEGEAFVGNMLVDMY 7
G+E+++ + K G+ + V N L+ MY
Sbjct: 346 WGKEIHSRVAKAGFTSDIGVQNALISMY 373



Score = 100 bits (250), Expect = 3e-20
Identities = 47/123 (38%), Positives = 77/123 (62%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D ++ L AC++ G+L+ R++H +++ G D V +A+V YAKCGS + VF
Sbjct: 529 DKVTYINMLNACANSGSLEWAREIHTLVRKGGFFSDTSVGNALVSTYAKCGSFSDASIVF 588

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
++M R+V++W +I G + G G++AL FE+M+++GV PD ++ V L AC +AG E
Sbjct: 589 EKMTKRNVISWNAIIGGSAQHGRGQDALQLFERMKMEGVKPDIVTFVSLLSACSHAGLLE 648

Query: 90 IGR 82
GR
Sbjct: 649 EGR 651



Score = 86.7 bits (213), Expect = 5e-16
Identities = 45/142 (31%), Positives = 78/142 (54%), Gaps = 2/142 (1%)
Frame = -2

Query: 426 LKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQV--R 253
LK C + L +GRQ+H + + + D +A+++ Y +CGS+ E R+V+ ++ R
Sbjct: 30 LKRCIEVKDLVAGRQVHQHIIQHRTVPDQYTVNALINMYIQCGSIEEARQVWKKLSYMER 89

Query: 252 DVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIGRELN 73
V +W ++ GY + G E+AL QMQ G+ PD +++ L +C GA E GRE++
Sbjct: 90 TVHSWNAMVVGYIQYGYIEKALKLLRQMQQHGLAPDRTTIMSFLSSCKSPGALEWGREIH 149

Query: 72 NVIYKCGYEGEAFVGNMLVDMY 7
+ G + V N +++MY
Sbjct: 150 FQAMQAGLLFDVKVANCILNMY 171


>tr|A7QIL2|A7QIL2_VITVI Chromosome chr9 scaffold_104, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00000307001
PE=4 SV=1
Length = 733

Score = 114 bits (286), Expect = 2e-24
Identities = 54/148 (36%), Positives = 86/148 (58%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
DN +V CS + L G Q+H + G D V+SA++D Y KCG+++ R+VF
Sbjct: 229 DNVTYVTAFGLCSHLKDLRLGLQVHCRMFRTGAEYDSFVSSAIIDMYGKCGNILNARKVF 288

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
+ +Q ++VV+WT ++ Y++ G EEAL F +M++DG+LP+ + L +C A
Sbjct: 289 NRLQTKNVVSWTAILAAYSQNGCFEEALNFFPEMEVDGLLPNEYTFAVLLNSCAGISALG 348

Query: 90 IGRELNNVIYKCGYEGEAFVGNMLVDMY 7
G+ L+ I K G+E VGN L++MY
Sbjct: 349 HGKLLHTRIKKSGFEDHIIVGNALINMY 376



Score = 86.7 bits (213), Expect = 5e-16
Identities = 48/137 (35%), Positives = 78/137 (56%), Gaps = 2/137 (1%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHV-VASAVVDFYAKCGSLVEVREV 274
+ + F L +C+ I AL G+ LH +K+ G +DH+ V +A+++ Y+K GS+ +V
Sbjct: 330 NEYTFAVLLNSCAGISALGHGKLLHTRIKKSG-FEDHIIVGNALINMYSKSGSIEAAHKV 388

Query: 273 FDEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGAS 94
F EM RD +TW+ +I G + GLG EAL F++M P ++ V L AC + G+
Sbjct: 389 FLEMICRDSITWSAMICGLSHHGLGREALVVFQEMLAAKECPHYVTFVGVLSACAHLGSV 448

Query: 93 EIG-RELNNVIYKCGYE 46
+ G LN ++ + G E
Sbjct: 449 QEGFYYLNQLMKQTGIE 465



Score = 67.0 bits (162), Expect = 4e-10
Identities = 43/143 (30%), Positives = 72/143 (50%), Gaps = 3/143 (2%)
Frame = -2

Query: 426 LKACSSIGALDSGRQLHAELKEMGRI-KDHVV-ASAVVDFYAKCGSLVEVREVFDEMQVR 253
LK + L G+ +HA L + KD++V +++++ YAKC ++ R +FD M+ R
Sbjct: 32 LKVSADTKNLKFGKMIHAHLIITNQATKDNIVQVNSLINLYAKCDQIMVARILFDGMRKR 91

Query: 252 DVVTWTTLIRGYTEQGLGEEALACFEQM-QIDGVLPDAISLVCSLKACGYAGASEIGREL 76
+VV+W L+ GY GL E L F+ M +D + P+ + +C +G G +
Sbjct: 92 NVVSWGALMAGYFHNGLVLEVLRLFKTMISVDYMRPNEYIFATIISSCSDSGQVVEGWQC 151

Query: 75 NNVIYKCGYEGEAFVGNMLVDMY 7
+ K G +V N L+ MY
Sbjct: 152 HGYALKSGLVFHQYVKNALICMY 174



Score = 63.2 bits (152), Expect = 6e-09
Identities = 34/148 (22%), Positives = 73/148 (49%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
+ + F + +CS G + G Q H + G + V +A++ Y++ + V+
Sbjct: 128 NEYIFATIISSCSDSGQVVEGWQCHGYALKSGLVFHQYVKNALICMYSRRSDVKGAMSVW 187

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
E+ DV ++ +I G E G EAL ++M + ++ D ++ V + C +
Sbjct: 188 YEVPGLDVFSYNIIINGLLENGYPSEALEVLDRMVDECIVWDNVTYVTAFGLCSHLKDLR 247

Query: 90 IGRELNNVIYKCGYEGEAFVGNMLVDMY 7
+G +++ +++ G E ++FV + ++DMY
Sbjct: 248 LGLQVHCRMFRTGAEYDSFVSSAIIDMY 275


>tr|A9T938|A9T938_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_192787 PE=4 SV=1
Length = 804

Score = 114 bits (285), Expect = 2e-24
Identities = 60/149 (40%), Positives = 82/149 (55%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D F FV L ACSS L+ GR++H + E G D V +A++ YAKCGS+ + R VF
Sbjct: 128 DKFTFVSILSACSSPAVLNWGREIHVRVMEAGLANDTTVGNALISMYAKCGSVRDARRVF 187

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
D M RD V+WTTL Y E G GEE+L + M + V P I+ + L ACG A E
Sbjct: 188 DAMASRDEVSWTTLTGAYAESGYGEESLKTYHAMLQERVRPSRITYMNVLSACGSLAALE 247

Query: 90 IGRELNNVIYKCGYEGEAFVGNMLVDMYV 4
G++++ I + Y + V L MY+
Sbjct: 248 KGKQIHAHIVESEYHSDVRVSTALTKMYM 276



Score = 105 bits (261), Expect = 1e-21
Identities = 53/140 (37%), Positives = 78/140 (55%)
Frame = -2

Query: 426 LKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVFDEMQVRDV 247
L AC S+ AL+ G+Q+HA + E D V++A+ Y KCG+ + REVF+ + RDV
Sbjct: 237 LSACGSLAALEKGKQIHAHIVESEYHSDVRVSTALTKMYMKCGAFKDAREVFECLSYRDV 296

Query: 246 VTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASEIGRELNNV 67
+ W T+IRG+ + G EEA F +M +GV PD + L AC G G+E++
Sbjct: 297 IAWNTMIRGFVDSGQLEEAHGTFHRMLEEGVAPDRATYTTVLSACARPGGLARGKEIHAR 356

Query: 66 IYKCGYEGEAFVGNMLVDMY 7
K G + GN L++MY
Sbjct: 357 AAKDGLVSDVRFGNALINMY 376



Score = 99.8 bits (247), Expect = 6e-20
Identities = 52/148 (35%), Positives = 82/148 (55%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D + L AC+ G L G+++HA + G + D +A+++ Y+K GS+ + R+VF
Sbjct: 330 DRATYTTVLSACARPGGLARGKEIHARAAKDGLVSDVRFGNALINMYSKAGSMKDARQVF 389

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
D M RDVV+WTTL+ Y + E+ F+QM GV + I+ +C LKAC A +
Sbjct: 390 DRMPKRDVVSWTTLLGRYADCDQVVESFTTFKQMLQQGVKANKITYMCVLKACSNPVALK 449

Query: 90 IGRELNNVIYKCGYEGEAFVGNMLVDMY 7
G+E++ + K G + V N L+ MY
Sbjct: 450 WGKEIHAEVVKAGLLADLAVTNALMSMY 477



Score = 99.0 bits (245), Expect = 1e-19
Identities = 51/123 (41%), Positives = 75/123 (60%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
+ ++C LKACS+ AL G+++HAE+ + G + D V +A++ Y KCGS+ + VF
Sbjct: 431 NKITYMCVLKACSNPVALKWGKEIHAEVVKAGLLADLAVTNALMSMYFKCGSVEDAIRVF 490

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
+ M +RDVVTW TLI G + G G EAL +E M+ +G+ P+A + V L AC E
Sbjct: 491 EGMSMRDVVTWNTLIGGLGQNGRGLEALQRYEVMKSEGMRPNAATFVNVLSACRVCNLVE 550

Query: 90 IGR 82
GR
Sbjct: 551 EGR 553



Score = 93.6 bits (231), Expect = 4e-18
Identities = 47/148 (31%), Positives = 78/148 (52%)
Frame = -2

Query: 450 DNFAFVCGLKACSSIGALDSGRQLHAELKEMGRIKDHVVASAVVDFYAKCGSLVEVREVF 271
D++ +V L++C L G+Q+H + G + + + ++ YA CGS+ E R++F
Sbjct: 27 DSYDYVKLLQSCVKAKDLAVGKQVHEHILRCGVKPNVYITNTLLKLYAHCGSVNEARQLF 86

Query: 270 DEMQVRDVVTWTTLIRGYTEQGLGEEALACFEQMQIDGVLPDAISLVCSLKACGYAGASE 91
D+ + VV+W +I GY +GL +EA F MQ + + PD + V L AC
Sbjct: 87 DKFSNKSVVSWNVMISGYAHRGLAQEAFNLFTLMQQERLEPDKFTFVSILSACSSPAVLN 146

Query: 90 IGRELNNVIYKCGYEGEAFVGNMLVDMY 7
GRE++ + + G + VGN L+ MY
Sbjct: 147 WGREIHVRVMEAGLANDTTVGNALISMY 174