BP916691
Clone id YMU001_000090_D11
Library
Length 561
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000090_D11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATAGAATCTGCAAGTGACAAAATCCCTACCCGGATTAGGCTCTCAAAAGAGTGAACATCA
TAAAAATATAACCATTGTGAAGACACGACCTGTATGGCCGTAGCCCAAGTCTACATCTCA
ATTGAAAAAAATGTCTGTCGACTGGGTCTTCAACATGTACACCAGCTGTAATGTTGATGC
TGACAACTTTGCCTTGGAGCAGTGTGCTCCAGAAAAGCGTCTCTCAAGAGACCGCAAAAA
AAAGTGGTTGATGTGTGCTAGAAACTCCCCTATAAAACCGGGTGTCAATGTAGACTAGGA
ATGTTGGTGTTGATTTTTGTCACCGGATGGAAATGTACTTGATACATATGTCGGGCGTCA
CTCCTCTATGACAGAGGTACCTCGCCGTGAATGCCATGAGTAAAATTATCGGCGAATTCG
ATGCCAAAAAATGAAATCAATGCCGCCTTTTGCCACCAAACGGAAGCACTTGCCGGTGTC
GATAGTCACTAAAGTCGGTGTCGGAAACGCCTCTAATGTCAAGACCCAATGTCAGAATCT
AGCTGATTGCAGAAATCAGTG
■■Homology search results ■■ -
sp_hit_id Q8WN92
Definition sp|Q8WN92|VN1R1_GORGO Vomeronasal type-1 receptor 1 OS=Gorilla gorilla gorilla
Align length 50
Score (bit) 30.4
E-value 6.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916691|Adiantum capillus-veneris mRNA, clone:
YMU001_000090_D11.
(561 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8WN92|VN1R1_GORGO Vomeronasal type-1 receptor 1 OS=Gorilla g... 30 6.2
sp|O59782|SULH3_SCHPO Probable sulfate permease C320.05 OS=Schiz... 30 6.3
sp|P48651|PTSS1_HUMAN Phosphatidylserine synthase 1 OS=Homo sapi... 30 8.2

>sp|Q8WN92|VN1R1_GORGO Vomeronasal type-1 receptor 1 OS=Gorilla
gorilla gorilla GN=VN1R1 PE=3 SV=1
Length = 353

Score = 30.4 bits (67), Expect = 6.2
Identities = 18/50 (36%), Positives = 26/50 (52%)
Frame = -2

Query: 194 RQSCQHQHYSWCTC*RPSRQTFFSIEM*TWATAIQVVSSQWLYFYDVHSF 45
+Q QH H + +C RPS++T + I V+ S + FY VHSF
Sbjct: 250 KQQVQHNHSNRLSC-RPSQETRAT-------RTIMVLVSSFFVFYSVHSF 291


>sp|O59782|SULH3_SCHPO Probable sulfate permease C320.05
OS=Schizosaccharomyces pombe GN=SPCC320.05 PE=2 SV=1
Length = 667

Score = 30.4 bits (67), Expect = 6.3
Identities = 15/52 (28%), Positives = 26/52 (50%)
Frame = -1

Query: 402 YSWHSRRGTSVIEE*RPTYVSSTFPSGDKNQHQHS*STLTPGFIGEFLAHIN 247
+ WHS G +++ E + T + P +KN+ +L G + FLA I+
Sbjct: 295 FDWHSNYGIAILGEIKTTILLPKLPLPEKNKLHFITQSLQTGVMCSFLAFID 346


>sp|P48651|PTSS1_HUMAN Phosphatidylserine synthase 1 OS=Homo sapiens
GN=PTDSS1 PE=1 SV=1
Length = 473

Score = 30.0 bits (66), Expect = 8.2
Identities = 13/41 (31%), Positives = 22/41 (53%)
Frame = -1

Query: 399 SWHSRRGTSVIEE*RPTYVSSTFPSGDKNQHQHS*STLTPG 277
SWH R+GT E+ P + + + +++HS S +T G
Sbjct: 429 SWHHRKGTKGSEDSPPKHAGNNESHSSRRRNRHSKSKVTNG 469


tr_hit_id Q094I7
Definition tr|Q094I7|Q094I7_STIAU Aminotransferase, class III family OS=Stigmatella aurantiaca DW4/3-1
Align length 57
Score (bit) 35.8
E-value 1.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916691|Adiantum capillus-veneris mRNA, clone:
YMU001_000090_D11.
(561 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q094I7|Q094I7_STIAU Aminotransferase, class III family OS=Sti... 36 1.7
tr|B8I979|B8I979_CLOCE Amino acid adenylation domain protein OS=... 36 1.7

>tr|Q094I7|Q094I7_STIAU Aminotransferase, class III family
OS=Stigmatella aurantiaca DW4/3-1 GN=STIAU_0525 PE=4 SV=1
Length = 3433

Score = 35.8 bits (81), Expect = 1.7
Identities = 20/57 (35%), Positives = 26/57 (45%), Gaps = 3/57 (5%)
Frame = -1

Query: 546 SARF*HWVLTLEAF---PTPTLVTIDTGKCFRLVAKGGIDFIFWHRIRR*FYSWHSR 385
+AR V TL AF + + G FR V KG +D F+H + R Y W R
Sbjct: 1520 NARTARLVATLNAFFEAQHAPIQVVSFGSLFRFVLKGNLDLFFFHLVNRGVYVWEGR 1576


>tr|B8I979|B8I979_CLOCE Amino acid adenylation domain protein
OS=Clostridium cellulolyticum H10 GN=Ccel_0977 PE=4 SV=1
Length = 3739

Score = 35.8 bits (81), Expect = 1.7
Identities = 14/33 (42%), Positives = 20/33 (60%)
Frame = -1

Query: 483 IDTGKCFRLVAKGGIDFIFWHRIRR*FYSWHSR 385
++ G FR V KG I+ +F+H I+R Y W R
Sbjct: 1256 VNYGSLFRFVLKGDIELLFYHLIKRGIYVWEGR 1288