BP916698
Clone id YMU001_000090_E06
Library
Length 551
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000090_E06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GCTCAAATGGCATCAAACCTATAACAGAACTATGTGTAGTGCAATCAACCCATAAAGAAA
ATGGTAGGATTTTAGGCCAATCACCAATATGTCCCTGGTATGATTTTGCTAAAACTTTAA
CAATAGGTAGATGCCCTCTTTCACTTTCACCATTACCCTCTGGATTGTATGATGTAGTGA
GAGCCAACTTAATGCCCAAAGAAGCAAATAAATCCCAAGCTTCATCTGCATCCAGGTCTC
CTCTATCAGCAATAATTATACCAACACATCCATACCTAAAATAACATCCTCAAGCAAGAA
CTTGCATACATAAATGGTAGCTTTTCTATGCAAAGCTCTGCCTTCTACCTGATTAGTAAG
ATCTTCTATGGCAAGAACAATGTACCGCATCTACCAAACACCTATTGGCATGGTAATCGG
GTCCACCACCCACTTTTAGTGCATAGCTAGTGGATAGATGGGATGCAATCGATCTTGATG
TCCCACATTAGAATACTGTTGACATATTAAGCATGTATCCACAAACTGAGCCACATCTAT
ATACCTTTCCA
■■Homology search results ■■ -
sp_hit_id Q9TTC1
Definition sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus
Align length 94
Score (bit) 34.7
E-value 0.0004
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916698|Adiantum capillus-veneris mRNA, clone:
YMU001_000090_E06.
(551 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pr... 35 4e-04
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Sa... 40 0.008
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Sa... 40 0.010
sp|P03359|POL_WMSV Pol polyprotein (Fragment) OS=Woolly monkey s... 33 0.043
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogen... 36 0.14
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus ty... 35 0.24
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus typ... 35 0.32
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus ... 35 0.32
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (... 35 0.32
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus... 34 0.54
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus... 33 0.92
sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation muri... 33 1.2
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia... 33 1.2
sp|P03355|POL_MLVMO Pol polyprotein OS=Moloney murine leukemia v... 32 1.6
sp|P08361|POL_MLVCB Pol polyprotein (Fragment) OS=Cas-Br-E murin... 32 1.6
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia vi... 32 2.0
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia vi... 32 2.0
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia vi... 32 2.0
sp|Q5UPA2|YL023_MIMIV Putative ankyrin repeat protein L23 OS=Aca... 31 3.5
sp|P51517|POL_SRV2 Pol polyprotein OS=Simian retrovirus SRV-2 GN... 30 7.8

>sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol
PE=3 SV=1
Length = 1127

Score = 34.7 bits (78), Expect(2) = 4e-04
Identities = 27/94 (28%), Positives = 44/94 (46%), Gaps = 2/94 (2%)
Frame = -2

Query: 277 RYGCVGIIIADRGD-LDADEAWDLFASLGIKLALTTSYNPEGNGESERGHLPIVKVLAK- 104
R+G ++ +D G A + L LGI L +Y P+ +G+ ER + I + L K
Sbjct: 894 RFGIPKVLGSDNGPAFVAQVSQGLATQLGIDWKLHCAYRPQSSGQVERMNRTIKETLTKL 953

Query: 103 SYQGHIGDWPKILPFSLWVDCTTHSSVIGLMPFE 2
+ + DW +LP +L + GL P+E
Sbjct: 954 ALETGGKDWVTLLPLAL-LRARNTPGQFGLTPYE 986



Score = 28.9 bits (63), Expect(2) = 4e-04
Identities = 14/51 (27%), Positives = 27/51 (52%)
Frame = -3

Query: 432 WVVDPITMPIGVW*MRYIVLAIEDLTNQVEGRALHRKATIYVCKFLLEDVI 280
W VD + G + RY+++ I+ + VE + + VCK +LE+++
Sbjct: 842 WEVDFTEVKPGRYGNRYLLVFIDTFSGWVEAFPTKTETALTVCKKILEEIL 892


>sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY3B-I PE=3 SV=2
Length = 1498

Score = 40.0 bits (92), Expect = 0.008
Identities = 27/92 (29%), Positives = 49/92 (53%), Gaps = 1/92 (1%)
Frame = -2

Query: 274 YGCVGIIIADRG-DLDADEAWDLFASLGIKLALTTSYNPEGNGESERGHLPIVKVLAKSY 98
+G I +DR + AD+ +L LGIK ++++ +P+ +G+SER + ++L
Sbjct: 1253 HGFPRTITSDRDVRMTADKYQELTKRLGIKSTMSSANHPQTDGQSERTIQTLNRLLRAYV 1312

Query: 97 QGHIGDWPKILPFSLWVDCTTHSSVIGLMPFE 2
+I +W LP +V +T + +G PFE
Sbjct: 1313 STNIQNWHVYLPQIEFVYNSTPTRTLGKSPFE 1344


>sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY3B-G PE=1 SV=3
Length = 1547

Score = 39.7 bits (91), Expect = 0.010
Identities = 27/92 (29%), Positives = 49/92 (53%), Gaps = 1/92 (1%)
Frame = -2

Query: 274 YGCVGIIIADRG-DLDADEAWDLFASLGIKLALTTSYNPEGNGESERGHLPIVKVLAKSY 98
+G I +DR + AD+ +L LGIK ++++ +P+ +G+SER + ++L
Sbjct: 1227 HGFPRTITSDRDVRMTADKYQELTKRLGIKSTMSSANHPQTDGQSERTIQTLNRLLRAYA 1286

Query: 97 QGHIGDWPKILPFSLWVDCTTHSSVIGLMPFE 2
+I +W LP +V +T + +G PFE
Sbjct: 1287 STNIQNWHVYLPQIEFVYNSTPTRTLGKSPFE 1318


>sp|P03359|POL_WMSV Pol polyprotein (Fragment) OS=Woolly monkey
sarcoma virus GN=pol PE=3 SV=1
Length = 294

Score = 33.5 bits (75), Expect(2) = 0.043
Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 1/71 (1%)
Frame = -2

Query: 211 LFASLGIKLALTTSYNPEGNGESERGHLPIVKVLAK-SYQGHIGDWPKILPFSLWVDCTT 35
L LGI L +Y P+ +G+ ER + I + L K + + DW +LP +L +
Sbjct: 84 LATQLGINWKLHCAYRPQSSGQVERMNRTIKETLTKLALETGGKDWVALLPLAL-LRAKN 142

Query: 34 HSSVIGLMPFE 2
S GL P+E
Sbjct: 143 TPSRFGLTPYE 153



Score = 23.1 bits (48), Expect(2) = 0.043
Identities = 12/44 (27%), Positives = 21/44 (47%)
Frame = -3

Query: 432 WVVDPITMPIGVW*MRYIVLAIEDLTNQVEGRALHRKATIYVCK 301
W VD + G + RY+++ I+ + VE + + VCK
Sbjct: 13 WEVDFTEVKPGRYGNRYLLVFIDTFSGWVEAFPTKTETALTVCK 56


>sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous
virus ECE1 GN=pol PE=3 SV=1
Length = 1046

Score = 35.8 bits (81), Expect = 0.14
Identities = 26/94 (27%), Positives = 47/94 (50%), Gaps = 2/94 (2%)
Frame = -2

Query: 277 RYGCVGIIIADRGDLDADE-AWDLFASLGIKLALTTSYNPEGNGESERGHLPIVKVLAK- 104
R+G +I +D G + + L +LGI L +Y P+ +G+ ER + I + L K
Sbjct: 817 RFGLPKVIGSDNGPAFVSQVSQGLARTLGINWKLHCAYRPQSSGQVERMNRTIKETLTKL 876

Query: 103 SYQGHIGDWPKILPFSLWVDCTTHSSVIGLMPFE 2
+ + + DW ++L +L + + GL P+E
Sbjct: 877 TLETGLKDWRRLLSLAL-LRARNTPNRFGLTPYE 909


>sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3
(strain LK3) GN=pol PE=3 SV=2
Length = 1143

Score = 35.0 bits (79), Expect = 0.24
Identities = 16/45 (35%), Positives = 26/45 (57%)
Frame = -2

Query: 196 GIKLALTTSYNPEGNGESERGHLPIVKVLAKSYQGHIGDWPKILP 62
GI+L +T Y+P+ +G+ ER + I ++L K G W +LP
Sbjct: 953 GIQLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPAKWYDLLP 997


>sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1
GN=pol PE=1 SV=3
Length = 1149

Score = 34.7 bits (78), Expect = 0.32
Identities = 16/45 (35%), Positives = 26/45 (57%)
Frame = -2

Query: 196 GIKLALTTSYNPEGNGESERGHLPIVKVLAKSYQGHIGDWPKILP 62
GI+L +T Y+P+ +G+ ER + I ++L K G W +LP
Sbjct: 953 GIQLEFSTPYHPQSSGKVERKNSDIKRLLTKLLIGRPAKWYDLLP 997


>sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus
GN=pol PE=3 SV=1
Length = 1165

Score = 34.7 bits (78), Expect = 0.32
Identities = 27/94 (28%), Positives = 44/94 (46%), Gaps = 2/94 (2%)
Frame = -2

Query: 277 RYGCVGIIIADRGD-LDADEAWDLFASLGIKLALTTSYNPEGNGESERGHLPIVKVLAK- 104
R+G ++ +D G A + L LGI L +Y P+ +G+ ER + I + L K
Sbjct: 932 RFGIPKVLGSDNGPAFVAQVSQGLATQLGINWKLHCAYRPQSSGQVERMNRTIKETLTKL 991

Query: 103 SYQGHIGDWPKILPFSLWVDCTTHSSVIGLMPFE 2
+ + DW +LP +L + GL P+E
Sbjct: 992 ALETGGKDWVTLLPLAL-LRARNTPGRFGLTPYE 1024


>sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus
(strain M7) GN=pol PE=3 SV=1
Length = 1189

Score = 34.7 bits (78), Expect = 0.32
Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 2/94 (2%)
Frame = -2

Query: 277 RYGCVGIIIADRGDLDADE-AWDLFASLGIKLALTTSYNPEGNGESERGHLPIVKVLAK- 104
R+G +I +D G + + L LGI L +Y P+ +G+ ER + I + L K
Sbjct: 960 RFGLPKVIGSDNGPAFVSQVSQGLARILGINWKLHCAYRPQSSGQVERMNRTIKETLTKL 1019

Query: 103 SYQGHIGDWPKILPFSLWVDCTTHSSVIGLMPFE 2
+ + + DW ++L +L + + GL P+E
Sbjct: 1020 TLETGLKDWRRLLSLAL-LRARNTPNRFGLTPYE 1052


>sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus
GN=pol PE=3 SV=2
Length = 1196

Score = 33.9 bits (76), Expect = 0.54
Identities = 27/94 (28%), Positives = 43/94 (45%), Gaps = 2/94 (2%)
Frame = -2

Query: 277 RYGCVGIIIADRGDLDADEAWDLFASL-GIKLALTTSYNPEGNGESERGHLPIVKVLAK- 104
R+G ++ +D G + A L GI L +Y P+ +G+ ER + I + L K
Sbjct: 965 RFGMPQVLGSDNGPAFTSQVSQSVADLLGIDWKLHCAYRPQSSGQVERMNRTIKETLTKL 1024

Query: 103 SYQGHIGDWPKILPFSLWVDCTTHSSVIGLMPFE 2
+ DW +LP +L+ T GL P+E
Sbjct: 1025 TLAAGTRDWVLLLPLALYRARNT-PGPHGLTPYE 1057


tr_hit_id A9TWP1
Definition tr|A9TWP1|A9TWP1_PHYPA Predicted protein (Fragment) OS=Physcomitrella patens subsp. patens
Align length 90
Score (bit) 102.0
E-value 1.0e-20
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916698|Adiantum capillus-veneris mRNA, clone:
YMU001_000090_E06.
(551 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TWP1|A9TWP1_PHYPA Predicted protein (Fragment) OS=Physcomit... 102 1e-20
tr|B3GGB9|B3GGB9_PODAN Gag-pol polyprotein OS=Podospora anserina... 59 8e-14
tr|A5BF20|A5BF20_VITVI Putative uncharacterized protein OS=Vitis... 50 3e-09
tr|Q75G47|Q75G47_ORYSJ Putative polyprotein OS=Oryza sativa subs... 44 4e-09
tr|A5AGD6|A5AGD6_VITVI Putative uncharacterized protein OS=Vitis... 49 8e-09
tr|Q45W58|Q45W58_PHACH Polyprotein (Fragment) OS=Phanerochaete c... 48 8e-09
tr|Q7X805|Q7X805_ORYSJ OSJNBb0103I08.2 protein (OSJNBa0011L07.17... 42 1e-08
tr|Q01IP3|Q01IP3_ORYSA H0115B09.9 protein OS=Oryza sativa GN=H01... 42 1e-08
tr|Q2QZU9|Q2QZU9_ORYSJ Retrotransposon protein, putative, Ty3-gy... 41 2e-08
tr|A5BRH8|A5BRH8_VITVI Putative uncharacterized protein OS=Vitis... 49 3e-08
tr|A6SHV6|A6SHV6_BOTFB Putative uncharacterized protein OS=Botry... 46 1e-07
tr|A6RNZ8|A6RNZ8_BOTFB Putative uncharacterized protein OS=Botry... 46 1e-07
tr|Q9ZNW4|Q9ZNW4_SORBI Polyprotein OS=Sorghum bicolor PE=4 SV=1 49 2e-07
tr|Q2QT15|Q2QT15_ORYSJ Retrotransposon protein, putative, Ty3-gy... 41 3e-07
tr|Q15F66|Q15F66_9MICR Pol polyprotein OS=Nosema bombycis PE=4 SV=1 40 7e-07
tr|A5BVZ6|A5BVZ6_VITVI Putative uncharacterized protein OS=Vitis... 44 9e-07
tr|Q9ZTP2|Q9ZTP2_MAIZE Prpol OS=Zea mays PE=4 SV=1 41 1e-06
tr|Q9SHM5|Q9SHM5_ARATH F7F22.15 OS=Arabidopsis thaliana PE=4 SV=1 46 2e-06
tr|A5B0Q3|A5B0Q3_VITVI Putative uncharacterized protein OS=Vitis... 48 2e-06
tr|Q2R3E6|Q2R3E6_ORYSJ Os11g0524800 protein OS=Oryza sativa subs... 54 2e-06
tr|A9TMX8|A9TMX8_PHYPA Predicted protein (Fragment) OS=Physcomit... 55 2e-06
tr|A8NJ42|A8NJ42_COPC7 Putative uncharacterized protein OS=Copri... 49 3e-06
tr|A5C747|A5C747_VITVI Putative uncharacterized protein OS=Vitis... 54 4e-06
tr|A5B3S7|A5B3S7_VITVI Putative uncharacterized protein OS=Vitis... 43 5e-06
tr|Q9MFD2|Q9MFD2_BETVU Orf764 protein OS=Beta vulgaris subsp. vu... 54 5e-06
tr|Q5U6F6|Q5U6F6_BETVU Orf764 protein OS=Beta vulgaris subsp. vu... 54 5e-06
tr|A5AH69|A5AH69_VITVI Putative uncharacterized protein OS=Vitis... 54 5e-06
tr|Q9SHM3|Q9SHM3_ARATH F7F22.17 OS=Arabidopsis thaliana PE=4 SV=1 44 7e-06
tr|Q94I18|Q94I18_ORYSA Putative retroelement OS=Oryza sativa GN=... 42 7e-06
tr|Q33A35|Q33A35_ORYSJ Retrotransposon protein, putative, Ty3-gy... 42 7e-06

>tr|A9TWP1|A9TWP1_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_53485 PE=4 SV=1
Length = 96

Score = 102 bits (254), Expect = 1e-20
Identities = 49/90 (54%), Positives = 60/90 (66%)
Frame = -2

Query: 277 RYGCVGIIIADRGDLDADEAWDLFASLGIKLALTTSYNPEGNGESERGHLPIVKVLAKSY 98
RYGC+ I D G+LD EA + F GIKL+LTTSYN E SER H IVK L K+
Sbjct: 7 RYGCMEKITTDCGELDVHEAHEFFKRCGIKLSLTTSYNSEKKANSERRHALIVKALVKAC 66

Query: 97 QGHIGDWPKILPFSLWVDCTTHSSVIGLMP 8
G + +WP++LP++LWVD TTHSSV MP
Sbjct: 67 NGRVREWPRLLPYALWVDQTTHSSVTKYMP 96


>tr|B3GGB9|B3GGB9_PODAN Gag-pol polyprotein OS=Podospora anserina PE=4
SV=1
Length = 2603

Score = 58.5 bits (140), Expect(2) = 8e-14
Identities = 31/91 (34%), Positives = 46/91 (50%)
Frame = -2

Query: 277 RYGCVGIIIADRGDLDADEAWDLFASLGIKLALTTSYNPEGNGESERGHLPIVKVLAKSY 98
R+G I++ D G EA ++ LG+ + + YN NG +E GH+PI +LAK
Sbjct: 2253 RWGHPLIVVVDGGSEFRKEAAEILERLGVLRVVVSPYNARANGVTESGHIPIASMLAKMT 2312

Query: 97 QGHIGDWPKILPFSLWVDCTTHSSVIGLMPF 5
G W + LP+ L+ D TT + G F
Sbjct: 2313 DGTGKKWKQWLPYVLFADRTTTRGIHGYSAF 2343



Score = 41.6 bits (96), Expect(2) = 8e-14
Identities = 30/90 (33%), Positives = 42/90 (46%), Gaps = 1/90 (1%)
Frame = -3

Query: 543 YIDVAQFVDTCLICQQYSNVGHQDRLHPIYPLAM-H*KWVVDPITMPIGVW*MRYIVLAI 367
Y DV ++ TC CQQ+S +D PLA KW +D +P Y++ A
Sbjct: 2163 YADVEAWIKTCRQCQQWSPKRWEDWHLYTEPLATPFAKWHLDVQFLPTASGEKAYLLEAR 2222

Query: 366 EDLTNQVEGRALHRKATIYVCKFLLEDVIL 277
+DLT E + L V F+L D+IL
Sbjct: 2223 DDLTGYPEAKVLSSGKASGVENFILHDIIL 2252


>tr|A5BF20|A5BF20_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_028866 PE=4 SV=1
Length = 1189

Score = 50.1 bits (118), Expect(2) = 3e-09
Identities = 31/91 (34%), Positives = 46/91 (50%)
Frame = -2

Query: 277 RYGCVGIIIADRGDLDADEAWDLFASLGIKLALTTSYNPEGNGESERGHLPIVKVLAKSY 98
RYG +I+DRG E L GI+ +++Y P+ NG E + I ++L K
Sbjct: 981 RYGVPHELISDRGVHFKGEVDTLVQEYGIQHHKSSAYRPQTNGVVEAANKNIKRILRKMV 1040

Query: 97 QGHIGDWPKILPFSLWVDCTTHSSVIGLMPF 5
+ DW K LPF+LW T+ + IG P+
Sbjct: 1041 ETS-RDWSKKLPFALWAYRTSFRTSIGATPY 1070



Score = 34.7 bits (78), Expect(2) = 3e-09
Identities = 28/93 (30%), Positives = 42/93 (45%), Gaps = 7/93 (7%)
Frame = -3

Query: 537 DVAQFVDTCLICQQYSNVGH--QDRLHPI---YPLAMH*KWVVDPI--TMPIGVW*MRYI 379
D QFV C CQ + ++ H LH + +P ++ W +D I P YI
Sbjct: 890 DCCQFVQRCQECQMHGDLIHVPPSELHALTSPWPFSV---WGIDIIGKISPKSSSGHEYI 946

Query: 378 VLAIEDLTNQVEGRALHRKATIYVCKFLLEDVI 280
++AI+ T VE + R T V KF+ +I
Sbjct: 947 LVAIDYFTKWVEAASYARLTTARVAKFIRSHII 979


>tr|Q75G47|Q75G47_ORYSJ Putative polyprotein OS=Oryza sativa subsp.
japonica GN=B1003C08.10 PE=4 SV=1
Length = 1459

Score = 43.5 bits (101), Expect(2) = 4e-09
Identities = 28/93 (30%), Positives = 46/93 (49%), Gaps = 2/93 (2%)
Frame = -2

Query: 277 RYGCVGIIIADRG-DLDADEAWDLFASLGIKLALTTSYNPEGNGESERGHLPIVKVLAKS 101
R+G I+ D G ++++ DL L +K+ + +P+ NG ER + +V+ + K
Sbjct: 1236 RFGIPKEIVCDNGKQFESEKFKDLCQGLHLKINFASVGHPQTNGAVERANGKVVEAIKKR 1295

Query: 100 YQGHI-GDWPKILPFSLWVDCTTHSSVIGLMPF 5
+G G WP+ L LW TT G+ PF
Sbjct: 1296 LEGSSKGKWPEDLLSVLWALRTTVVWATGMTPF 1328



Score = 40.8 bits (94), Expect(2) = 4e-09
Identities = 24/89 (26%), Positives = 47/89 (52%), Gaps = 3/89 (3%)
Frame = -3

Query: 537 DVAQFVDTCLICQQY--SNVGHQDRLHPIYPLAMH*KWVVDPI-TMPIGVW*MRYIVLAI 367
D Q++ TC CQ+ S+ L PI P+ +W +D + +P +R++++AI
Sbjct: 1146 DTEQYIKTCRACQKVGSSSKAPPKELQPIPPVWPFYRWGIDIVGPLPRAKGDLRFVIVAI 1205

Query: 366 EDLTNQVEGRALHRKATIYVCKFLLEDVI 280
E + +E A+ R + + KF+ +++I
Sbjct: 1206 EYFSRWIEAEAVARITSAAMQKFVWKNII 1234


>tr|A5AGD6|A5AGD6_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_000670 PE=4 SV=1
Length = 752

Score = 48.5 bits (114), Expect(2) = 8e-09
Identities = 30/92 (32%), Positives = 46/92 (50%)
Frame = -2

Query: 280 FRYGCVGIIIADRGDLDADEAWDLFASLGIKLALTTSYNPEGNGESERGHLPIVKVLAKS 101
+RYG +I+DRG E L GI+ +++Y P+ NG E + I ++L K
Sbjct: 543 YRYGVPHELISDRGVHFKGEVDTLIQEYGIQHHRSSAYRPQTNGAVEVANKNIKRILRKM 602

Query: 100 YQGHIGDWPKILPFSLWVDCTTHSSVIGLMPF 5
+ DW + LPF+LW T + IG P+
Sbjct: 603 VETS-RDWSEKLPFTLWAYRTFFRTSIGATPY 633



Score = 34.7 bits (78), Expect(2) = 8e-09
Identities = 27/90 (30%), Positives = 37/90 (41%), Gaps = 4/90 (4%)
Frame = -3

Query: 537 DVAQFVDTCLICQQYSNVGH--QDRLHPIYPLAMH*KWVVDPI--TMPIGVW*MRYIVLA 370
D QFV C CQ + ++ H LH + P W +D I P YI++A
Sbjct: 453 DCCQFVQRCQECQMHGDLIHVPPSELHELAPPWPFSVWGIDIIGKISPKSSSGHEYILVA 512

Query: 369 IEDLTNQVEGRALHRKATIYVCKFLLEDVI 280
I T VE + R V KF+ +I
Sbjct: 513 ISYFTKWVEAASYARLTAARVAKFIRSHII 542


>tr|Q45W58|Q45W58_PHACH Polyprotein (Fragment) OS=Phanerochaete
chrysosporium RP-78 GN=pol PE=4 SV=1
Length = 638

Score = 47.8 bits (112), Expect(2) = 8e-09
Identities = 26/91 (28%), Positives = 43/91 (47%)
Frame = -2

Query: 277 RYGCVGIIIADRGDLDADEAWDLFASLGIKLALTTSYNPEGNGESERGHLPIVKVLAKSY 98
R+GCV +++ D G A ++ G+ + L++ Y+P+GNG +ER + VL +
Sbjct: 317 RFGCVPVLVCDGGAEFKGAAREILERHGVAVILSSPYHPQGNGIAERDGKTLQDVLLRCC 376

Query: 97 QGHIGDWPKILPFSLWVDCTTHSSVIGLMPF 5
WP L +L T S G P+
Sbjct: 377 GDKPNVWPSYLDAALLAIRVTTSRATGFTPY 407



Score = 35.4 bits (80), Expect(2) = 8e-09
Identities = 24/92 (26%), Positives = 44/92 (47%), Gaps = 6/92 (6%)
Frame = -3

Query: 537 DVAQFVDTCLICQQYSNVGHQDRLHPIYPLA------MH*KWVVDPITMPIGVW*MRYIV 376
DVA V +C +CQ ++ ++ PI P++ + ++V+D I MP G + +Y++
Sbjct: 230 DVAWHVRSCNVCQ------YRSKVRPIEPISFTLSPSVFRRFVLDTIYMPTGHYGYKYLL 283

Query: 375 LAIEDLTNQVEGRALHRKATIYVCKFLLEDVI 280
A E R + + KF+ E +I
Sbjct: 284 HASCSTAKWPEARGARKNTSSVWSKFIWESII 315


>tr|Q7X805|Q7X805_ORYSJ OSJNBb0103I08.2 protein (OSJNBa0011L07.17
protein) OS=Oryza sativa subsp. japonica
GN=OSJNBb0103I08.2 PE=4 SV=1
Length = 943

Score = 41.6 bits (96), Expect(2) = 1e-08
Identities = 27/93 (29%), Positives = 45/93 (48%), Gaps = 2/93 (2%)
Frame = -2

Query: 277 RYGCVGIIIADRG-DLDADEAWDLFASLGIKLALTTSYNPEGNGESERGHLPIVKVLAKS 101
R+G I+ D G ++ + D+ L +++ + +P+ NG ER + IV+ + K
Sbjct: 720 RFGIPKEIVCDNGKQFESGKFKDMCKGLNLQINFASVGHPQTNGAVERANGKIVEAIKKR 779

Query: 100 YQGHI-GDWPKILPFSLWVDCTTHSSVIGLMPF 5
+G G WP+ L LW TT G+ PF
Sbjct: 780 LEGSTKGKWPEDLLSVLWALRTTVVRSTGMTPF 812



Score = 41.2 bits (95), Expect(2) = 1e-08
Identities = 23/89 (25%), Positives = 47/89 (52%), Gaps = 3/89 (3%)
Frame = -3

Query: 537 DVAQFVDTCLICQQYSNVGHQD--RLHPIYPLAMH*KWVVDPI-TMPIGVW*MRYIVLAI 367
D +++ TC CQ++ L PI P+ + +W +D + +P +R++++AI
Sbjct: 630 DKEKYIKTCKACQKFGATSKAPPRELQPIPPVRLFYRWGLDIVGPLPRAKGDLRFVIVAI 689

Query: 366 EDLTNQVEGRALHRKATIYVCKFLLEDVI 280
E + +E A+ R + V KF+ +++I
Sbjct: 690 EYFSRWIEAEAVARITSASVQKFVWKNII 718


>tr|Q01IP3|Q01IP3_ORYSA H0115B09.9 protein OS=Oryza sativa
GN=H0115B09.9 PE=4 SV=1
Length = 943

Score = 41.6 bits (96), Expect(2) = 1e-08
Identities = 27/93 (29%), Positives = 45/93 (48%), Gaps = 2/93 (2%)
Frame = -2

Query: 277 RYGCVGIIIADRG-DLDADEAWDLFASLGIKLALTTSYNPEGNGESERGHLPIVKVLAKS 101
R+G I+ D G ++ + D+ L +++ + +P+ NG ER + IV+ + K
Sbjct: 720 RFGIPKEIVCDNGKQFESGKFKDMCKGLNLQINFASVGHPQTNGAVERANGKIVEAIKKR 779

Query: 100 YQGHI-GDWPKILPFSLWVDCTTHSSVIGLMPF 5
+G G WP+ L LW TT G+ PF
Sbjct: 780 LEGSTKGKWPEDLLSVLWALRTTVVRSTGMTPF 812



Score = 41.2 bits (95), Expect(2) = 1e-08
Identities = 23/89 (25%), Positives = 47/89 (52%), Gaps = 3/89 (3%)
Frame = -3

Query: 537 DVAQFVDTCLICQQYSNVGHQD--RLHPIYPLAMH*KWVVDPI-TMPIGVW*MRYIVLAI 367
D +++ TC CQ++ L PI P+ + +W +D + +P +R++++AI
Sbjct: 630 DKEKYIKTCKACQKFGATSKAPPRELQPIPPVRLFYRWGLDIVGPLPRAKGDLRFVIVAI 689

Query: 366 EDLTNQVEGRALHRKATIYVCKFLLEDVI 280
E + +E A+ R + V KF+ +++I
Sbjct: 690 EYFSRWIEAEAVARITSASVQKFVWKNII 718


>tr|Q2QZU9|Q2QZU9_ORYSJ Retrotransposon protein, putative, Ty3-gypsy
subclass OS=Oryza sativa subsp. japonica
GN=LOC_Os11g44770 PE=4 SV=1
Length = 1980

Score = 41.2 bits (95), Expect(2) = 2e-08
Identities = 23/89 (25%), Positives = 48/89 (53%), Gaps = 3/89 (3%)
Frame = -3

Query: 537 DVAQFVDTCLICQQYSNV--GHQDRLHPIYPLAMH*KWVVDPIT-MPIGVW*MRYIVLAI 367
D +++ TC CQ++ + L PI P+ +W +D ++ +P +R++++AI
Sbjct: 1667 DTEKYIKTCKACQKFGPMTKAPPKELQPIPPVWPFYRWGIDIVSPLPRAKGDLRFVIVAI 1726

Query: 366 EDLTNQVEGRALHRKATIYVCKFLLEDVI 280
E + +E A+ R + V KF+ +++I
Sbjct: 1727 EYFSRWIEAEAVARITSAAVQKFVWKNII 1755



Score = 40.8 bits (94), Expect(2) = 2e-08
Identities = 26/93 (27%), Positives = 45/93 (48%), Gaps = 2/93 (2%)
Frame = -2

Query: 277 RYGCVGIIIADRG-DLDADEAWDLFASLGIKLALTTSYNPEGNGESERGHLPIVKVLAKS 101
R+G I+ D G ++ + D+ L +++ + +P+ NG ER + I++ + K
Sbjct: 1757 RFGIPKEIVCDNGKQFESGKFQDMCKGLNLQINFASVGHPQTNGAVERANGKIMEAIKKR 1816

Query: 100 YQGHI-GDWPKILPFSLWVDCTTHSSVIGLMPF 5
+G G WP+ L LW TT G+ PF
Sbjct: 1817 LEGSAKGKWPEDLLSVLWALRTTVVRSTGMTPF 1849


>tr|A5BRH8|A5BRH8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_023681 PE=4 SV=1
Length = 505

Score = 49.3 bits (116), Expect(2) = 3e-08
Identities = 30/91 (32%), Positives = 46/91 (50%)
Frame = -2

Query: 277 RYGCVGIIIADRGDLDADEAWDLFASLGIKLALTTSYNPEGNGESERGHLPIVKVLAKSY 98
RYG +I+DRG E L GI+ +++Y P+ NG E + I ++L K
Sbjct: 359 RYGVPHELISDRGVHFKGEVDMLIQEYGIQXHRSSAYRPQTNGAVEAANKNIKRILRKMV 418

Query: 97 QGHIGDWPKILPFSLWVDCTTHSSVIGLMPF 5
+ DW + LPF+LW T+ + IG P+
Sbjct: 419 ETS-RDWSEKLPFALWAYRTSFRTSIGATPY 448



Score = 32.0 bits (71), Expect(2) = 3e-08
Identities = 25/90 (27%), Positives = 37/90 (41%), Gaps = 4/90 (4%)
Frame = -3

Query: 537 DVAQFVDTCLICQQYSNVGH--QDRLHPIYPLAMH*KWVVDPI--TMPIGVW*MRYIVLA 370
D QFV C CQ + ++ H LH + W +D I P YI++A
Sbjct: 268 DCCQFVQRCQECQMHGDLIHVPPSELHALTSPLPFSVWGIDIIGKISPKSSSGHEYILVA 327

Query: 369 IEDLTNQVEGRALHRKATIYVCKFLLEDVI 280
I+ T VE + R V KF+ ++
Sbjct: 328 IDYFTKWVEAASYARLTXTRVAKFIRSHIL 357