BP916701
Clone id YMU001_000090_E10
Library
Length 542
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000090_E10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GATGTGAGCCTCCGGACTTCTCGGGGCTCATCTTGTATGATGAACATGGGAATCATGTGC
AGGAGTTCCCTGCAAGTCTCCCAAGTTTTCGGCACAGCGGCCTCTTCCGCTTGTAGTATG
ACAGGTGAATTGTTTTATTGGAGTAACTTGATATCGAACAAGTATGTTTTTCTTGTTCAA
CTTGCCACCAACAATAGGGAAAGCTGAACTACTTGTACTTGTCCTGGGGTTTGTAAAGCT
TGCAATGTTTTCAAGCTTGAGTAGCAGAGGAGAAAAGAAAAAGAAAACTAGAAGAGAGCA
GCTTTACTGGTTGTATTATCATTCATCTTTAGGTGCAATGCGCCTTGGTGGAGGCCATTT
CACGCAAAGATGACACTCTTGGCACTACTGATCACTGAGAATTAGTGGAGCCTTTGTATG
GTTATGGTATATGTAGGGATTTCTTTTATCTATGATAGTGAGCGAGGAGTTAGGGACCTC
AAAGATTAGTTTTATAGAAACTTGAATTAATTTGTAACGAAAGAGTGTTATGCTTATTCA
CA
■■Homology search results ■■ -
sp_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916701|Adiantum capillus-veneris mRNA, clone:
YMU001_000090_E10.
(542 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done

***** No hits found ******


tr_hit_id A9P2J3
Definition tr|A9P2J3|A9P2J3_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 27
Score (bit) 40.4
E-value 0.061
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916701|Adiantum capillus-veneris mRNA, clone:
YMU001_000090_E10.
(542 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9P2J3|A9P2J3_PICSI Putative uncharacterized protein OS=Picea... 40 0.061
tr|A5B734|A5B734_VITVI Putative uncharacterized protein OS=Vitis... 36 1.1
tr|A7PGN5|A7PGN5_VITVI Chromosome chr17 scaffold_16, whole genom... 35 2.0
tr|Q6EQW0|Q6EQW0_ORYSJ Putative uncharacterized protein OSJNBa00... 35 3.3
tr|B8AGB8|B8AGB8_ORYSI Putative uncharacterized protein OS=Oryza... 35 3.3
tr|B6TSI3|B6TSI3_MAIZE Putative uncharacterized protein OS=Zea m... 34 4.4
tr|B6HAC0|B6HAC0_PENCH Pc16g12290 protein OS=Penicillium chrysog... 34 4.4
tr|Q9M9A2|Q9M9A2_ARATH F27J15.21 (At1g49000) OS=Arabidopsis thal... 34 5.7
tr|A9RJL9|A9RJL9_PHYPA Predicted protein OS=Physcomitrella paten... 33 7.4
tr|B7P7Q4|B7P7Q4_IXOSC Cytochrome P450, putative (Fragment) OS=I... 33 9.7

>tr|A9P2J3|A9P2J3_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 159

Score = 40.4 bits (93), Expect = 0.061
Identities = 15/27 (55%), Positives = 20/27 (74%)
Frame = +3

Query: 3 CEPPDFSGLILYDEHGNHVQEFPASLP 83
C+PP FSGLI+YD+ GN + +FP P
Sbjct: 121 CQPPAFSGLIIYDDKGNRLPQFPPRSP 147


>tr|A5B734|A5B734_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_020012 PE=4 SV=1
Length = 198

Score = 36.2 bits (82), Expect = 1.1
Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 5/36 (13%)
Frame = +3

Query: 3 CEPPDFSGLILYDEHGNHVQEFP-----ASLPSFRH 95
C+ P+FSG+I YD +GN V E P + LPSF +
Sbjct: 112 CQHPEFSGVIFYDGYGNQVSEPPRTPRASPLPSFSY 147


>tr|A7PGN5|A7PGN5_VITVI Chromosome chr17 scaffold_16, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00017622001
PE=4 SV=1
Length = 72

Score = 35.4 bits (80), Expect = 2.0
Identities = 14/27 (51%), Positives = 17/27 (62%)
Frame = +3

Query: 3 CEPPDFSGLILYDEHGNHVQEFPASLP 83
C+P DFSG+I YD G +QE P P
Sbjct: 34 CQPLDFSGVIYYDNKGEQLQELPLRSP 60


>tr|Q6EQW0|Q6EQW0_ORYSJ Putative uncharacterized protein
OSJNBa0086N11.28 OS=Oryza sativa subsp. japonica
GN=OSJNBa0086N11.28 PE=4 SV=1
Length = 202

Score = 34.7 bits (78), Expect = 3.3
Identities = 14/20 (70%), Positives = 16/20 (80%)
Frame = +3

Query: 3 CEPPDFSGLILYDEHGNHVQ 62
CE P FSGLILYDEHG ++
Sbjct: 149 CELPRFSGLILYDEHGRPIR 168


>tr|B8AGB8|B8AGB8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_06972 PE=4 SV=1
Length = 195

Score = 34.7 bits (78), Expect = 3.3
Identities = 14/20 (70%), Positives = 16/20 (80%)
Frame = +3

Query: 3 CEPPDFSGLILYDEHGNHVQ 62
CE P FSGLILYDEHG ++
Sbjct: 150 CELPRFSGLILYDEHGRPIR 169


>tr|B6TSI3|B6TSI3_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 226

Score = 34.3 bits (77), Expect = 4.4
Identities = 14/20 (70%), Positives = 16/20 (80%)
Frame = +3

Query: 3 CEPPDFSGLILYDEHGNHVQ 62
CE P FSG+ILYDEHG +Q
Sbjct: 171 CELPRFSGVILYDEHGRPLQ 190


>tr|B6HAC0|B6HAC0_PENCH Pc16g12290 protein OS=Penicillium
chrysogenum Wisconsin 54-1255 GN=Pc16g12290 PE=4 SV=1
Length = 340

Score = 34.3 bits (77), Expect = 4.4
Identities = 21/68 (30%), Positives = 32/68 (47%)
Frame = -3

Query: 225 RTSTSSSAFPIVGGKLNKKNILVRYQVTPIKQFTCHTTSGRGRCAENLGDLQGTPAHDSH 46
R STSSS + + V Q P +++ ++G+ GD TPAH SH
Sbjct: 11 RASTSSSTSTLRRPITPRSQPQVLRQARPQRRYNSDFSAGK-----TPGDRNATPAHSSH 65

Query: 45 VHHTR*AP 22
HH++ +P
Sbjct: 66 SHHSKTSP 73


>tr|Q9M9A2|Q9M9A2_ARATH F27J15.21 (At1g49000) OS=Arabidopsis
thaliana GN=At1g49000 PE=2 SV=1
Length = 156

Score = 33.9 bits (76), Expect = 5.7
Identities = 14/27 (51%), Positives = 17/27 (62%)
Frame = +3

Query: 3 CEPPDFSGLILYDEHGNHVQEFPASLP 83
CEP DFSG+I YD +G + E P P
Sbjct: 118 CEPLDFSGVIYYDSNGRLLNEVPPRSP 144


>tr|A9RJL9|A9RJL9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_66997 PE=4 SV=1
Length = 132

Score = 33.5 bits (75), Expect = 7.4
Identities = 13/21 (61%), Positives = 16/21 (76%)
Frame = +3

Query: 3 CEPPDFSGLILYDEHGNHVQE 65
C+P FSGL+LYDE GN + E
Sbjct: 110 CKPLSFSGLVLYDEKGNRLPE 130


>tr|B7P7Q4|B7P7Q4_IXOSC Cytochrome P450, putative (Fragment)
OS=Ixodes scapularis GN=IscW_ISCW002574 PE=4 SV=1
Length = 662

Score = 33.1 bits (74), Expect = 9.7
Identities = 25/70 (35%), Positives = 33/70 (47%), Gaps = 7/70 (10%)
Frame = +2

Query: 122 QVNCFIGVT*YRTSMFFLFNLPPTIGKAELLVLVLGFVKLAMFSSLSSRGE-------KK 280
+VN T YRT + F L P +G AEL LV G VKL + +G +
Sbjct: 475 KVNLVCEKTGYRTELEF--KLKPFLGGAELCNLVTGKVKLGKETLFLIQGHWDGQITLRD 532

Query: 281 KKTRREQLYW 310
K+T EQ+ W
Sbjct: 533 KRTEEEQVLW 542