BP916702
Clone id YMU001_000090_E11
Library
Length 552
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000090_E11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTTTTTAATTGCAAGTCCAAAAACAATCTTTGGCTCTTTAAATTGCTTATTTCATGACGC
AAGGGTGGCCTTCCCAGCCCTTCATCCAGCCAGCTTTCTTATTTGATGACACGTCATTCA
ATTCAAGAGTGGGTCTTCTCAGCCCTTCAGTTTTCTTATCTGTCACATCCATTCAGATGC
ATCACGTGCAACATTTATGCCCTCTCATTCAAACTTTGTACCTGAGCTACTTCCATGGGT
CTAGAATCTCACACCCATTTAAAACTTGTATGTCTTGGATATTGCACTTGGCCTGGGTGT
CAAACCAGGTAATGTCGAGTGTAAGCCATATGGTCACAGTCACTCCAGTCATGCCATTGC
TTTGATGTGTGGCACACTGAATAGCGATTCTTGACGCTTTCGATTCAAGTCATCAGTTGC
GAGATTTGCTCTTTAGATAGACAATCCACTTACTGCCTTTTGATGCCTCATAATTCAGTA
AAATAGAGAGGTTAATGCTCTTAAAATGCAAGGTAGGTCTCAAAACGCAATTTCACACAC
TTCCTCTGTCGA
■■Homology search results ■■ -
sp_hit_id P97443
Definition sp|P97443|SMYD1_MOUSE SET and MYND domain-containing protein 1 OS=Mus musculus
Align length 62
Score (bit) 30.8
E-value 4.6
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916702|Adiantum capillus-veneris mRNA, clone:
YMU001_000090_E11.
(552 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P97443|SMYD1_MOUSE SET and MYND domain-containing protein 1 O... 31 4.6
sp|Q8NB12|SMYD1_HUMAN SET and MYND domain-containing protein 1 O... 31 4.6

>sp|P97443|SMYD1_MOUSE SET and MYND domain-containing protein 1
OS=Mus musculus GN=Smyd1 PE=1 SV=2
Length = 485

Score = 30.8 bits (68), Expect = 4.6
Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 2/62 (3%)
Frame = +1

Query: 121 IQEWVFSALQFS--YLSHPFRCITCNIYALSFKLCT*ATSMGLESHTHLKLVCLGYCTWP 294
+Q W + QFS Y+SH F I CN + LS + A +G+ + L + + WP
Sbjct: 150 LQYWPPQSQQFSMQYISHIFGVINCNGFTLSDQRGLQAVGVGIFPNLGL----VNHDCWP 205

Query: 295 GC 300
C
Sbjct: 206 NC 207


>sp|Q8NB12|SMYD1_HUMAN SET and MYND domain-containing protein 1
OS=Homo sapiens GN=SMYD1 PE=2 SV=1
Length = 490

Score = 30.8 bits (68), Expect = 4.6
Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 2/62 (3%)
Frame = +1

Query: 121 IQEWVFSALQFS--YLSHPFRCITCNIYALSFKLCT*ATSMGLESHTHLKLVCLGYCTWP 294
+Q W + QFS Y+SH F I CN + LS + A +G+ + L + + WP
Sbjct: 155 LQYWPPQSQQFSMQYISHIFGVINCNGFTLSDQRGLQAVGVGIFPNLGL----VNHDCWP 210

Query: 295 GC 300
C
Sbjct: 211 NC 212


tr_hit_id B4VIF1
Definition tr|B4VIF1|B4VIF1_9CYAN PAS fold family OS=Microcoleus chthonoplastes PCC 7420
Align length 42
Score (bit) 34.3
E-value 4.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916702|Adiantum capillus-veneris mRNA, clone:
YMU001_000090_E11.
(552 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B4VIF1|B4VIF1_9CYAN PAS fold family OS=Microcoleus chthonopla... 34 4.5
tr|B4MRG9|B4MRG9_DROWI GK15759 OS=Drosophila willistoni GN=GK157... 34 6.0

>tr|B4VIF1|B4VIF1_9CYAN PAS fold family OS=Microcoleus
chthonoplastes PCC 7420 GN=MC7420_7721 PE=4 SV=1
Length = 1525

Score = 34.3 bits (77), Expect = 4.5
Identities = 16/42 (38%), Positives = 22/42 (52%)
Frame = +2

Query: 113 VIQFKSGSSQPFSFLICHIHSDASRATFMPSHSNFVPELLPW 238
+IQ G+ F F HS+ R TF+ S+ N+ P L PW
Sbjct: 111 IIQANPGTD--FDFYTYSTHSEGDRKTFLESNKNYDPRLRPW 150


>tr|B4MRG9|B4MRG9_DROWI GK15759 OS=Drosophila willistoni GN=GK15759
PE=4 SV=1
Length = 265

Score = 33.9 bits (76), Expect = 6.0
Identities = 12/23 (52%), Positives = 17/23 (73%), Gaps = 1/23 (4%)
Frame = +1

Query: 241 LESHTH-LKLVCLGYCTWPGCQT 306
+E H H ++L+C Y TWPGC+T
Sbjct: 159 IEKHHHAMRLLCASYLTWPGCKT 181